(data stored in ACNUC9306 zone)

EMBL: BC098502

ID   BC098502; SV 1; linear; mRNA; STD; MUS; 2697 BP.
XX
AC   BC098502;
XX
DT   04-JUL-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus ezrin, mRNA (cDNA clone MGC:107499 IMAGE:30047137), complete
DE   cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2697
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2697
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-JUL-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 79b1604e935d4de45072656db6739e20.
DR   Ensembl-Gn; ENSMUSG00000052397; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023117; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023085; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023052; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023088; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022849; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023532; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022364; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022815; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022952; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022926; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023020; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022944; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023555; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022111; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022418; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000064234; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045456; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0045435; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0045399; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045407; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045153; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0045889; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045269; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0045056; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0045207; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0045172; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0045285; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045148; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0045954; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0044852; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044534; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Minoru Ko
CC   cDNA Library Preparation: Yulan Piao and Minoru Ko (National
CC   Institute on Aging, NIH: http://lgsun.grc.nia.nih.gov/cDNA/)
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 207 Row: d Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6678570.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2697
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIA Mouse Unfertilized Egg cDNA Library (Long)"
FT                   /clone="MGC:107499 IMAGE:30047137"
FT                   /tissue_type="Egg, unfertilized, mouse"
FT                   /note="Vector: pSPORT1"
FT                   /db_xref="taxon:10090"
FT   gene            1..2697
FT                   /gene="Ezr"
FT                   /note="synonym: p81"
FT   misc_difference 69
FT                   /gene="Ezr"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   CDS_pept        90..1850
FT                   /codon_start=1
FT                   /gene="Ezr"
FT                   /product="ezrin"
FT                   /db_xref="GOA:Q4KML7"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="MGI:MGI:98931"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KML7"
FT                   /protein_id="AAH98502.1"
FT                   /translation="MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYF
FT                   GLQYVDNKGFPTWLKLDKKVSAQEVRKENPVQFKFRAKFYPEDVAEELIQDITQKLFFL
FT                   QVKDGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEMHKSGYLSSERLIPQRVMDQHKL
FT                   SRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDA
FT                   LGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   QLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQM
FT                   LREKEELMLRLQDYEQKTKRAEKELSEQIEKALQLEEERRRAQEEAERLEADRMAALRA
FT                   KEELERQAQDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVK
FT                   TKEELHLVMTAPPPPPPPVYEPVNYHVQEGLQDEGAEPMGYSAELSSEGILDDRNEEKR
FT                   ITEAEKNERVQRQLLTLSNELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNT
FT                   KQRIDEFEAM"
XX
SQ   Sequence 2697 BP; 750 A; 666 C; 754 G; 527 T; 0 other;
     cccgacgcgt ctccgccgtc gccgtcgccg tcgcctccgc cgtacagccg aatagccgag        60
     gacccacgta gagccaccaa ccagccaaga tgcccaagcc aatcaacgtc cgggtgacca       120
     ccatggatgc cgagctggag tttgccatcc agccaaacac caccgggaag cagctctttg       180
     atcaggtggt aaagacgatt ggcctccggg aagtgtggta cttcggcctc cagtatgtag       240
     acaataaagg atttcctacc tggctgaaac ttgataaaaa ggtctccgca caggaggtcc       300
     gaaaggagaa ccctgtccag tttaaattcc gggccaagtt ctaccccgaa gacgtggccg       360
     aggaactcat ccaggacatc acacagaagc tcttcttcct gcaagtcaag gacgggatcc       420
     tcagcgacga gatctactgc cccccagaga cagccgtgct cctgggctcc tatgccgttc       480
     aggccaagtt cggagattat aacaaggaaa tgcacaagtc tgggtacctc agctcggagc       540
     ggctgatccc ccagagagtc atggaccaac acaagctcag cagggaccag tgggaggacc       600
     ggatccaggt gtggcacgcg gaacaccgag ggatgctcaa ggacagtgct atgctagaat       660
     acctgaagat tgcccaggac ctggaaatgt atgggatcaa ctatttcgag atcaaaaaca       720
     agaaaggaac agacctttgg cttggagtcg atgcccttgg acttaacatt tatgagaaag       780
     atgacaagtt gaccccaaag atcggcttcc cttggagtga gatcaggaac atctctttca       840
     acgacaagaa gtttgtcatt aagcccatcg acaagaaggc acctgacttt gtgttctacg       900
     ccccgcgcct gagaattaac aagcggatcc tgcagctctg catggggaac catgagctgt       960
     acatgcgccg caggaagccc gacaccatcg aggtgcagca gatgaaggcc caggctcggg      1020
     aggagaagca ccagaagcag ctagagcgac agcagttgga aaccgagaag aagaggcgag      1080
     agacggtgga gagagaaaag gagcagatgc tccgggagaa ggaggagctg atgcttcggc      1140
     tgcaggacta cgagcagaag accaagaggg cggagaaaga gctctccgag cagattgaga      1200
     aggccctcca actggaggaa gagaggaggc gagcccagga ggaggctgaa cgtctggagg      1260
     ccgaccgcat ggccgccctg cgggccaagg aagaactcga gagacaggcg caggatcaga      1320
     taaagagcca ggagcagctg gctgcagagc tggcagagta cacggccaag atcgcactgc      1380
     tggaggaggc gcggaggcgc aaggaggacg aggtagaaga gtggcagcac cgggctaaag      1440
     aagcccagga cgacctggtg aagaccaaag aggagctgca cctggtgatg acggccccac      1500
     cgcccccacc gcccccagtg tatgagcctg tgaattacca cgtgcaggag ggactgcagg      1560
     acgagggagc agagcctatg ggctacagtg ccgagctctc cagtgagggc atcctggatg      1620
     accgcaacga ggagaagcgg atcacagagg cagagaagaa tgagcgcgtg cagcggcagc      1680
     tgctgaccct gagcaatgag ttgtcccagg cccgggatga gaacaagagg acccacaatg      1740
     acatcatcca caacgagaac atgcggcaag gcagggacaa gtataagacg ctgcggcaaa      1800
     tcaggcaggg caacaccaag caacgcattg acgagttcga ggccatgtag aggccaggct      1860
     gggaccaagg gcagagggca cctcactgca ggcaggtgtc acacttggct ctttagttct      1920
     cttaagttta gacaccccct tgctgtgttc cagtccctta aagagcagtt acggggcctg      1980
     cattctgccc cgagacccag tgggctcctc cttggttcct tctaattgta tcacatagtg      2040
     ccaaacaggt cagatttaat gacagttacc gaatcacttc ctgtttggag cagggattcg      2100
     gagggctggc cctcatgaag caagattcat tgtcactggg acagcactgt ggctcacggg      2160
     tgccatactt ttctctagtt ttacaatgag ctcaaatcga ttttgttctt gatttttatg      2220
     aaggatccat ctctgtgtat tgaggggtaa aaatgatttt gaaatttgag tctaaagcat      2280
     gcccccacag agtctccttc ctccagaccg ctggcagagt ctccaggggt ccttcagagt      2340
     gtacggtaca ggactctccg atacaaaatt ctcatgctta tctgttagca tacattgttg      2400
     gacttatata tctaatgatc tgctatagag gatagtattt atatataagc gataatatgg      2460
     gtttgtaaca ttagttttaa aaaagggaaa gttttgttct gtatattttg ttacctttta      2520
     cagaataaaa gaattcaaca ttaagaacca tgtaaccgag acacttgatc tgacacaggg      2580
     gcagtcggga aaccgatgac tgcagtaatc accactgtac aaaaatgtta gtgggttttg      2640
     tgcacgtaaa atgcacactt ccatttcctg tcagtttctt atttgaaaaa aaaaaaa         2697
//

If you have problems or comments...

PBIL Back to PBIL home page