(data stored in ACNUC17492 zone)

EMBL: BC098681

ID   BC098681; SV 1; linear; mRNA; STD; ROD; 1319 BP.
XX
AC   BC098681;
XX
DT   04-JUL-2005 (Rel. 84, Created)
DT   18-JUL-2006 (Rel. 88, Last updated, Version 5)
XX
DE   Rattus norvegicus regulator of G-protein signaling 1, mRNA (cDNA clone
DE   MGC:112645 IMAGE:7385088), complete cds.
XX
KW   MGC.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1319
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1319
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-JUL-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8cc2318a60a289593390334980b8a8d5.
DR   Ensembl-Gn; ENSRNOG00000003895; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000005251; rattus_norvegicus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Drs. Josef Lazar  & Howard Jacob, Medical
CC   College of Wisconsin
CC   cDNA Library Preparation: Open Biosystems
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 225 Row: o Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 71895006.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1319
FT                   /organism="Rattus norvegicus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_251"
FT                   /clone="MGC:112645 IMAGE:7385088"
FT                   /tissue_type="Thymus, rat"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:10116"
FT   gene            1..1319
FT                   /gene="Rgs1"
FT   CDS_pept        197..685
FT                   /codon_start=1
FT                   /gene="Rgs1"
FT                   /product="regulator of G-protein signaling 1"
FT                   /db_xref="GOA:P97844"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR030409"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97844"
FT                   /protein_id="AAH98681.1"
FT                   /translation="MDMKAYLRSMIPHLESGMKSSKSKDILSAEEVMQWSQSLEKLLAN
FT                   QMGQNVFGKFLKSEFSEENIEFWLACEDYKKTETDLLHNKAEHIYKAFVHSDAVKQINI
FT                   DFHTRESTAKKIKTPTPTCFDEAQKVIYALMEKDSYPRFLKSNIYLNLLNDLQANTLK"
XX
SQ   Sequence 1319 BP; 465 A; 233 C; 273 G; 348 T; 0 other;
     ggaccatgag agctgcagcc atctccatgc caaggttgaa caaaatgcca ggaatgttct        60
     tctctgctag cccaaaggat tcaaaagaac caagccattc tcttctagat gacaacaagc       120
     aaaaaaagag gccaaagact ttataaaggg gaactcttct agagaattat gaatttttgc       180
     tgtcttttgt agtggaatgg acatgaaagc atatctaaga tctatgatcc ctcatctgga       240
     atctgggatg aaatcgtcca agtccaaaga catactttcg gctgaggaag taatgcagtg       300
     gtctcagtct ctggaaaaac tccttgccaa ccagatgggt caaaatgtct ttgggaaatt       360
     cctaaagtct gaattcagtg aagagaacat tgaattctgg ttggcttgtg aagactataa       420
     gaaaacagag actgatcttt tgcataacaa agcagagcat atatacaaag catttgtgca       480
     ctcagatgct gtgaaacaaa tcaatattga ctttcatact cgggaatcga cagccaagaa       540
     gatcaaaaca ccaactccca catgttttga tgaagcacaa aaagtcatat acgcacttat       600
     ggaaaaggat tcttatccca ggttcctgaa atcaaatatt tacttaaatc ttctaaatga       660
     ccttcaggcg aataccttaa agtgagtggt tccttgctga caggaattca aagatagtat       720
     caaggacaga aggaacatga gactgcctac aggatcagtc tggcctgcag aggagactca       780
     tcagtccgga gaagtgcaga tgaacggatt cacacagaat gtatctcggt ggagacttga       840
     ggaaacatcg caagaagaac agggtgaggc aagtggaagg agaaactgtg gtactgtcat       900
     gaaatacagt gggactctat tagacaaccc tcccaactgg ggaggtcagc tgactctggc       960
     aacacagaaa ctgtgaataa tttgtatgag actgattact atgtgctata agcttcaaga      1020
     acagcagacg tgtatgctac atgctgttgt gtacaatgtg ttgaactctg acaatctcct      1080
     tcctgtacat aatcagtcca aaagtatata ttgcaaatag gagttgctat tatagacatg      1140
     aagaactttt tatttgttta tttaattgta tttggcttgg agttgagaaa gacaattata      1200
     tatttaacct attttttaat ctaagaagtt ataacacatc tgtaaagtaa attatcactg      1260
     tggcaataat aaatgtgggc attacattaa aatagaaaaa aaaaaaaaaa aaaaaaaaa       1319
//

If you have problems or comments...

PBIL Back to PBIL home page