(data stored in ACNUC21429 zone)

EMBL: BC100419

ID   BC100419; SV 1; linear; mRNA; STD; MUS; 2374 BP.
XX
AC   BC100419;
XX
DT   03-AUG-2005 (Rel. 84, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus ubiquilin 3, mRNA (cDNA clone MGC:118221 IMAGE:30918401),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2374
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2374
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-AUG-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 0b4d13768abe547a3dec5773acb49f6e.
DR   Ensembl-Gn; ENSMUSG00000051618; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032703; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032678; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032611; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032688; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032399; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033184; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031728; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032367; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032521; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032474; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032614; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032508; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033211; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031442; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031843; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000057254; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0085536; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0085602; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0085546; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0085572; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085133; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086073; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085662; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085072; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0085266; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085120; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0085313; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085169; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0086356; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085068; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084189; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jonathan Kuo, NIMH
CC   cDNA Library Preparation: Michael Brownstein /  Ted Usdin
CC   Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 70 Row: f Column: 15
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 38348485.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2374
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_169"
FT                   /clone="MGC:118221 IMAGE:30918401"
FT                   /tissue_type="Testis, mouse"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:10090"
FT   gene            1..2374
FT                   /gene="Ubqln3"
FT   CDS_pept        88..2064
FT                   /codon_start=1
FT                   /gene="Ubqln3"
FT                   /product="ubiquilin 3"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:3045291"
FT                   /db_xref="UniProtKB/TrEMBL:Q497R3"
FT                   /protein_id="AAI00420.1"
FT                   /translation="MAKSGEALPQGSLAPAQDSQLIRVTVKTPKDKEDFSVVDTCTIRQ
FT                   LKEKISHRFKAHPNQLVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRTIGTECPS
FT                   PPVSIPGPNPGEIPQSSSVYSVDGSPSFSLGVLTGLSGLGLTSGSFSDQPGSLMWQHIS
FT                   VPELVAQLVDDPFIQGLLSNTGLVRQLVLDNPHMQHLIQQNPEIGHILNNPEIMRQTME
FT                   FLRNPSMMQEMMRSQDRALSNLESIPGGYNVLRTMYTDIMDPMLNAVQEQFGGNPFVTA
FT                   TTASTTTTSSQPSRTENCDPLPNPWTSTYGVSGGRQGRGGRQSGDQDASENRNRLPSFL
FT                   GNIGLFDYLQQLHETSQSLESYLQGTVPTSNPSQESPLSGNRVPPTLPSSPKSGSGQSL
FT                   PKESVAIKGKSSCPAFLRHSTENSTGQGGSLHDAGKGSTGPSTSLPNLTSQIGDSANRS
FT                   SFVSTPSSLMSATPGVPESPWLPPTGYSRSLRSAGTNQVPRIQNEIHQQLPLLLHLQTA
FT                   MANPRVMQALLQIEQGLQILATEAPRLLLWFMPCLTGLNGVTGGTEAREGVVMSEDPRP
FT                   TPTPQISLAQGSTELGIHSSPFLQVLQALASTNPQQLQLEAHFRVQLEQLRAMGFLNLE
FT                   ANLQALIATEGDVDAAVEKLRKS"
FT   misc_difference 2344..2374
FT                   /gene="Ubqln3"
FT                   /note="polyA tail: 31 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2374 BP; 625 A; 637 C; 537 G; 575 T; 0 other;
     gggcagtttg gagccctgcc taagaggaag gacggggcca cagcagattg ctgtgtcccc        60
     acagacctgg gtctcctgct gcccatcatg gccaaaagtg gagaggctct accacagggc       120
     agcctagcgc cagcccagga ttcccagctc atccgggtga cagtgaagac acccaaggac       180
     aaggaggatt tctcagttgt agacacatgc accatccggc agctaaagga aaaaatatca       240
     caccgcttta aggcacatcc aaatcagctg gtcctgatct ttgctggaaa aatcctcaag       300
     gaccctgact cattggcaca gtgtggagtg cgagatggcc tcacagtcca cctggtcatc       360
     aagatgcagc gtcggaccat aggcacagag tgcccatcac caccagtctc tattccaggc       420
     ccaaatcctg gagaaatccc tcagtcaagt tctgtttact ctgtggatgg gtctccttct       480
     ttcagcttag gggtcctcac aggcctcagt gggttaggtc tgacctcagg aagcttctct       540
     gaccagccag gctcactaat gtggcagcac atctcagtgc ctgaacttgt ggctcagctc       600
     gttgatgacc cctttatcca gggtctgctg tccaacacgg gcctagtgcg ccagttggtt       660
     cttgacaatc ctcacatgca gcacctgatc cagcagaacc ctgagattgg tcatattctt       720
     aacaaccctg agatcatgcg gcagacaatg gagtttcttc gtaacccttc catgatgcag       780
     gagatgatgc gtagccagga tcgtgcactc agtaacctgg agagcatccc tggtggctac       840
     aatgtgctcc gtactatgta cacagatatt atggatccca tgcttaatgc agtacaggaa       900
     caatttggtg gcaatccttt tgtcactgct actactgcta gtaccaccac caccagcagc       960
     caaccatcaa ggacagagaa ttgtgaccct ctgcccaacc cctggacttc cacatatggg      1020
     gtctcaggtg gaagacaagg aagaggtggc agacagtctg gggaccagga tgcatctgaa      1080
     aatagaaata ggcttccaag ctttctgggt aacataggac tctttgatta tcttcaacag      1140
     ttacatgaga cttctcagtc cctggaatct tatctgcagg gtactgtgcc aacttcaaat      1200
     ccaagccagg aatcaccact ttcaggaaac agagttcctc caactttacc atcatcccct      1260
     aaatctgggt caggccaatc tctgcccaaa gagtcagtag caatcaaggg aaagtcatca      1320
     tgcccagctt tcttgagaca ctcaactgag aacagtactg gacaaggtgg aagcctacat      1380
     gatgcaggga agggctctac tggccccagt actagcttgc ccaatcttac ctctcagata      1440
     ggagattctg ccaacagatc ctcgtttgtt tctacaccat cttcccttat gtcagctact      1500
     cctggagtcc cagaatctcc ctggcttcct ccaacaggtt actcaagatc tctgagatca      1560
     gcgggcacaa atcaagtccc tcgaatccag aatgagatac atcaacagct accactactg      1620
     ttgcatcttc agacagccat ggcaaatccc cgtgtcatgc aagccttgct gcagattgag      1680
     cagggtctac agattctggc tactgaagca ccccgcctcc tgctctggtt catgccctgc      1740
     ctaacagggt tgaatggagt aacaggaggc acagaagcta gagaaggtgt tgttatgtct      1800
     gaggatcccc gaccaacccc aactcctcag atttctctag cacaaggttc tacagagcta      1860
     ggtatccatt cctccccctt cctccaggtg ttacaagcct tagctagtac caatccccag      1920
     cagctacaac tggaggctca cttccgggta caactggagc aactgcgggc tatgggcttt      1980
     ctgaatcttg aagccaatct ccaggccctc attgctacag agggtgatgt agatgctgct      2040
     gtggagaaat tgaggaagtc ttaggagctc tagttatttg gaccatatct tttcctttct      2100
     gcctttcccc catgtcttat taccctagtt ctcctattct tgaatacagc tgcactataa      2160
     accaaattac tatgatgttc tttactgtgg agacaatgtt ctggagtcaa taaggaagat      2220
     gagaagccag aaatagggtg gggatgctgt gtaatccaac tgtgcctgac actcttttac      2280
     ctggggccct tgaatgagtt ctgtacctat cttgagatgc aattacatcc agtctttagt      2340
     gccgaaaaaa aaaaaaaaaa aaaaaaaaaa aaaa                                  2374
//

If you have problems or comments...

PBIL Back to PBIL home page