(data stored in SCRATCH zone)

EMBL: BC101632

ID   BC101632; SV 1; linear; mRNA; STD; HUM; 2360 BP.
XX
AC   BC101632;
XX
DT   21-SEP-2005 (Rel. 85, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens membrane metallo-endopeptidase, mRNA (cDNA clone MGC:126681
DE   IMAGE:8069138), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2360
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2360
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-AUG-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 91be4326bd8fd0d5d2c3357948c87ff0.
DR   Ensembl-Gn; ENSG00000196549; homo_sapiens.
DR   Ensembl-Tr; ENST00000360490; homo_sapiens.
DR   Ensembl-Tr; ENST00000460393; homo_sapiens.
DR   Ensembl-Tr; ENST00000462745; homo_sapiens.
DR   Ensembl-Tr; ENST00000492661; homo_sapiens.
DR   Ensembl-Tr; ENST00000493237; homo_sapiens.
DR   Ensembl-Tr; ENST00000615825; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Mike Brownstein, NIMH
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCB Plate: 2 Row: G Column: 24.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2360
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_311"
FT                   /clone="MGC:126681 IMAGE:8069138"
FT                   /tissue_type="Brain, cerebellum, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: GGTAGCAT"
FT                   /db_xref="taxon:9606"
FT   gene            1..2360
FT                   /gene="MME"
FT                   /note="synonyms: CALLA, CD10, NEP"
FT   misc_feature    1..2360
FT                   /gene="MME"
FT                   /note="This cDNA sequence aligns to the human reference
FT                   genome (build 36) without differences"
FT   CDS_pept        79..2331
FT                   /codon_start=1
FT                   /gene="MME"
FT                   /product="membrane metallo-endopeptidase"
FT                   /db_xref="GOA:P08473"
FT                   /db_xref="H-InvDB:HIT000336990.10"
FT                   /db_xref="HGNC:HGNC:7154"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029727"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="PDB:1DL9"
FT                   /db_xref="PDB:1DMT"
FT                   /db_xref="PDB:1QVD"
FT                   /db_xref="PDB:1R1H"
FT                   /db_xref="PDB:1R1I"
FT                   /db_xref="PDB:1R1J"
FT                   /db_xref="PDB:1Y8J"
FT                   /db_xref="PDB:2QPJ"
FT                   /db_xref="PDB:2YB9"
FT                   /db_xref="PDB:4CTH"
FT                   /db_xref="PDB:5JMY"
FT                   /db_xref="PDB:6GID"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08473"
FT                   /protein_id="AAI01633.1"
FT                   /translation="MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTM
FT                   IALYATYDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRY
FT                   GNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPD
FT                   IYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQP
FT                   RLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEK
FT                   EIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITN
FT                   EEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALY
FT                   GTTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDL
FT                   TWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKF
FT                   SQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYG
FT                   GIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAG
FT                   GQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVW
FT                   CGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW"
XX
SQ   Sequence 2360 BP; 766 A; 452 C; 522 G; 620 T; 0 other;
     tgggggctgg gaatttgcca ttctgctgta cagacactga tttttttttc ttctttttaa        60
     aaagcaagat tttaggtgat gggcaagtca gaaagtcaga tggatataac tgatatcaac       120
     actccaaagc caaagaagaa acagcgatgg actccactgg agatcagcct ctcggtcctt       180
     gtcctgctcc tcaccatcat agctgtgaca atgatcgcac tctatgcaac ctacgatgat       240
     ggtatttgca agtcatcaga ctgcataaaa tcagctgctc gactgatcca aaacatggat       300
     gccaccactg agccttgtac agactttttc aaatatgctt gcggaggctg gttgaaacgt       360
     aatgtcattc ccgagaccag ctcccgttac ggcaactttg acattttaag agatgaacta       420
     gaagtcgttt tgaaagatgt ccttcaagaa cccaaaactg aagatatagt agcagtgcag       480
     aaagcaaaag cattgtacag gtcttgtata aatgaatctg ctattgatag cagaggtgga       540
     gaacctctac tcaaactgtt accagacata tatgggtggc cagtagcaac agaaaactgg       600
     gagcaaaaat atggtgcttc ttggacagct gaaaaagcta ttgcacaact gaattctaaa       660
     tatgggaaaa aagtccttat taatttgttt gttggcactg atgataagaa ttctgtgaat       720
     catgtaattc atattgacca acctcgactt ggcctccctt ctagagatta ctatgaatgc       780
     actggaatct ataaagaggc ttgtacagca tatgtggatt ttatgatttc tgtggccaga       840
     ttgattcgtc aggaagaaag attgcccatc gatgaaaacc agcttgcttt ggaaatgaat       900
     aaagttatgg aattggaaaa agaaattgcc aatgctacgg ctaaacctga agatcgaaat       960
     gatccaatgc ttctgtataa caagatgaca ttggcccaga tccaaaataa cttttcacta      1020
     gagatcaatg ggaagccatt cagctggttg aatttcacaa atgaaatcat gtcaactgtg      1080
     aatattagta ttacaaatga ggaagatgtg gttgtttatg ctccagaata tttaaccaaa      1140
     cttaagccca ttcttaccaa atattctgcc agagatcttc aaaatttaat gtcctggaga      1200
     ttcataatgg atcttgtaag cagcctcagc cgaacctaca aggagtccag aaatgctttc      1260
     cgcaaggccc tttatggtac aacctcagaa acagcaactt ggagacgttg tgcaaactat      1320
     gtcaatggga atatggaaaa tgctgtgggg aggctttatg tggaagcagc atttgctgga      1380
     gagagtaaac atgtggtcga ggatttgatt gcacagatcc gagaagtttt tattcagact      1440
     ttagatgacc tcacttggat ggatgccgag acaaaaaaga gagctgaaga aaaggcctta      1500
     gcaattaaag aaaggatcgg ctatcctgat gacattgttt caaatgataa caaactgaat      1560
     aatgagtacc tcgagttgaa ctacaaagaa gatgaatact tcgagaacat aattcaaaat      1620
     ttgaaattca gccaaagtaa acaactgaag aagctccgag aaaaggtgga caaagatgag      1680
     tggataagtg gagcagctgt agtcaatgca ttttactctt caggaagaaa tcagatagtc      1740
     ttcccagccg gcattctgca gccccccttc tttagtgccc agcagtccaa ctcattgaac      1800
     tatgggggca tcggcatggt cataggacac gaaatcaccc atggcttcga tgacaatggc      1860
     agaaacttta acaaagatgg agacctcgtt gactggtgga ctcaacagtc tgcaagtaac      1920
     tttaaggagc aatcccagtg catggtgtat cagtatggaa acttttcctg ggacctggca      1980
     ggtggacagc accttaatgg aattaataca ctgggagaaa acattgctga taatggaggt      2040
     cttggtcaag catacagagc ctatcagaat tatattaaaa agaatggcga agaaaaatta      2100
     cttcctggac ttgacctaaa tcacaaacaa ctatttttct tgaactttgc acaggtgtgg      2160
     tgtggaacct ataggccaga gtatgcggtt aactccatta aaacagatgt gcacagtcca      2220
     ggcaatttca ggattattgg gactttgcag aactctgcag agttttcaga agcctttcac      2280
     tgccgcaaga attcatacat gaatccagaa aagaagtgcc gggtttggtg atcttcaaaa      2340
     gaagcattgc agcccttggc                                                  2360
//

If you have problems or comments...

PBIL Back to PBIL home page