(data stored in SCRATCH zone)

EMBL: BC101658

ID   BC101658; SV 1; linear; mRNA; STD; HUM; 2350 BP.
XX
AC   BC101658;
XX
DT   21-SEP-2005 (Rel. 85, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens membrane metallo-endopeptidase, mRNA (cDNA clone MGC:126707
DE   IMAGE:8069164), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2350
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2350
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-AUG-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; bd809b0d4d0a1ae9a42782e2d4b2e677.
DR   Ensembl-Gn; ENSG00000196549; homo_sapiens.
DR   Ensembl-Tr; ENST00000360490; homo_sapiens.
DR   Ensembl-Tr; ENST00000460393; homo_sapiens.
DR   Ensembl-Tr; ENST00000462745; homo_sapiens.
DR   Ensembl-Tr; ENST00000492661; homo_sapiens.
DR   Ensembl-Tr; ENST00000493237; homo_sapiens.
DR   Ensembl-Tr; ENST00000615825; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Mike Brownstein, NIMH
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCB Plate: 2 Row: I Column: 2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2350
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_311"
FT                   /clone="MGC:126707 IMAGE:8069164"
FT                   /tissue_type="Brain, cerebellum, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: GCCAAGGG"
FT                   /db_xref="taxon:9606"
FT   gene            1..2350
FT                   /gene="MME"
FT                   /note="synonyms: CALLA, CD10, NEP"
FT   misc_feature    1..2350
FT                   /gene="MME"
FT                   /note="This cDNA sequence aligns to the human reference
FT                   genome (build 36) without differences"
FT   CDS_pept        77..2329
FT                   /codon_start=1
FT                   /gene="MME"
FT                   /product="membrane metallo-endopeptidase"
FT                   /db_xref="GOA:P08473"
FT                   /db_xref="H-InvDB:HIT000337015.10"
FT                   /db_xref="HGNC:HGNC:7154"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029727"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="PDB:1DL9"
FT                   /db_xref="PDB:1DMT"
FT                   /db_xref="PDB:1QVD"
FT                   /db_xref="PDB:1R1H"
FT                   /db_xref="PDB:1R1I"
FT                   /db_xref="PDB:1R1J"
FT                   /db_xref="PDB:1Y8J"
FT                   /db_xref="PDB:2QPJ"
FT                   /db_xref="PDB:2YB9"
FT                   /db_xref="PDB:4CTH"
FT                   /db_xref="PDB:5JMY"
FT                   /db_xref="PDB:6GID"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08473"
FT                   /protein_id="AAI01659.1"
FT                   /translation="MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTM
FT                   IALYATYDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRY
FT                   GNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPD
FT                   IYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQP
FT                   RLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEK
FT                   EIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITN
FT                   EEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALY
FT                   GTTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDL
FT                   TWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKF
FT                   SQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYG
FT                   GIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAG
FT                   GQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVW
FT                   CGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW"
XX
SQ   Sequence 2350 BP; 766 A; 448 C; 519 G; 617 T; 0 other;
     ggggctggga atttgccatt ctgctgtaca gacactgatt tttttttctt ctttttaaaa        60
     agcaagattt taggtgatgg gcaagtcaga aagtcagatg gatataactg atatcaacac       120
     tccaaagcca aagaagaaac agcgatggac tccactggag atcagcctct cggtccttgt       180
     cctgctcctc accatcatag ctgtgacaat gatcgcactc tatgcaacct acgatgatgg       240
     tatttgcaag tcatcagact gcataaaatc agctgctcga ctgatccaaa acatggatgc       300
     caccactgag ccttgtacag actttttcaa atatgcttgc ggaggctggt tgaaacgtaa       360
     tgtcattccc gagaccagct cccgttacgg caactttgac attttaagag atgaactaga       420
     agtcgttttg aaagatgtcc ttcaagaacc caaaactgaa gatatagtag cagtgcagaa       480
     agcaaaagca ttgtacaggt cttgtataaa tgaatctgct attgatagca gaggtggaga       540
     acctctactc aaactgttac cagacatata tgggtggcca gtagcaacag aaaactggga       600
     gcaaaaatat ggtgcttctt ggacagctga aaaagctatt gcacaactga attctaaata       660
     tgggaaaaaa gtccttatta atttgtttgt tggcactgat gataagaatt ctgtgaatca       720
     tgtaattcat attgaccaac ctcgacttgg cctcccttct agagattact atgaatgcac       780
     tggaatctat aaagaggctt gtacagcata tgtggatttt atgatttctg tggccagatt       840
     gattcgtcag gaagaaagat tgcccatcga tgaaaaccag cttgctttgg aaatgaataa       900
     agttatggaa ttggaaaaag aaattgccaa tgctacggct aaacctgaag atcgaaatga       960
     tccaatgctt ctgtataaca agatgacatt ggcccagatc caaaataact tttcactaga      1020
     gatcaatggg aagccattca gctggttgaa tttcacaaat gaaatcatgt caactgtgaa      1080
     tattagtatt acaaatgagg aagatgtggt tgtttatgct ccagaatatt taaccaaact      1140
     taagcccatt cttaccaaat attctgccag agatcttcaa aatttaatgt cctggagatt      1200
     cataatggat cttgtaagca gcctcagccg aacctacaag gagtccagaa atgctttccg      1260
     caaggccctt tatggtacaa cctcagaaac agcaacttgg agacgttgtg caaactatgt      1320
     caatgggaat atggaaaatg ctgtggggag gctttatgtg gaagcagcat ttgctggaga      1380
     gagtaaacat gtggtcgagg atttgattgc acagatccga gaagttttta ttcagacttt      1440
     agatgacctc acttggatgg atgccgagac aaaaaagaga gctgaagaaa aggccttagc      1500
     aattaaagaa aggatcggct atcctgatga cattgtttca aatgataaca aactgaataa      1560
     tgagtacctc gagttgaact acaaagaaga tgaatacttc gagaacataa ttcaaaattt      1620
     gaaattcagc caaagtaaac aactgaagaa gctccgagaa aaggtggaca aagatgagtg      1680
     gataagtgga gcagctgtag tcaatgcatt ttactcttca ggaagaaatc agatagtctt      1740
     cccagccggc attctgcagc cccccttctt tagtgcccag cagtccaact cattgaacta      1800
     tgggggcatc ggcatggtca taggacacga aatcacccat ggcttcgatg acaatggcag      1860
     aaactttaac aaagatggag acctcgttga ctggtggact caacagtctg caagtaactt      1920
     taaggagcaa tcccagtgca tggtgtatca gtatggaaac ttttcctggg acctggcagg      1980
     tggacagcac cttaatggaa ttaatacact gggagaaaac attgctgata atggaggtct      2040
     tggtcaagca tacagagcct atcagaatta tattaaaaag aatggcgaag aaaaattact      2100
     tcctggactt gacctaaatc acaaacaact atttttcttg aactttgcac aggtgtggtg      2160
     tggaacctat aggccagagt atgcggttaa ctccattaaa acagatgtgc acagtccagg      2220
     caatttcagg attattggga ctttgcagaa ctctgcagag ttttcagaag cctttcactg      2280
     ccgcaagaat tcatacatga atccagaaaa gaagtgccgg gtttggtgat cttcaaaaga      2340
     agcattgcag                                                             2350
//

If you have problems or comments...

PBIL Back to PBIL home page