(data stored in ACNUC9306 zone)

EMBL: BC102573

ID   BC102573; SV 1; linear; mRNA; STD; MAM; 2720 BP.
XX
AC   BC102573;
XX
DT   19-AUG-2005 (Rel. 84, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Bos taurus ezrin, mRNA (cDNA clone MGC:127826 IMAGE:7954178), complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-2720
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (15-AUG-2005) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; 61f6a1fe1dc41c1a09b2aa4583036a4e.
DR   Ensembl-Gn; ENSBTAG00000010347; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000013663; bos_taurus.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: M. Taniguchi, Y. Meng, L. Guan and S. Moore,
CC   University of Alberta
CC   cDNA Library Preparation: M. Masaaki, Y. Meng, S. Lobo,  L. Guan
CC   and Dr. S. Moore
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Tanaguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Chun E, Liao N, Beland J, Cruz K, Featherstone R, Kirk H,
CC   Matsuo C, Mayo M, Moore R, Munro S, Roger J, Tam B, Trinh E, Sze W,
CC   Wilton J, Wanger S, Huang P, Chu B, Imanian B, Roscoe R, Holt R,
CC   Jones S, Marra M
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 242 Row: a Column: 10.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2720
FT                   /organism="Bos taurus"
FT                   /lab_host="XL10-Gold"
FT                   /strain="Crossbred x Angus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-02"
FT                   /clone="MGC:127826 IMAGE:7954178"
FT                   /tissue_type="Ileum, crossbred X Angus female calf, 6
FT                   months old."
FT                   /note="Vector: pCMV-SPORT6.0"
FT                   /db_xref="taxon:9913"
FT   gene            1..2720
FT                   /gene="EZR"
FT                   /note="synonym: VIL2"
FT   CDS_pept        175..1920
FT                   /codon_start=1
FT                   /gene="EZR"
FT                   /product="ezrin"
FT                   /db_xref="GOA:P31976"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31976"
FT                   /protein_id="AAI02574.1"
FT                   /translation="MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYF
FT                   GLQYVDNKGFPTWLKLDKKVSAQEVRKESPLQFKFRAKFYPEDVAEELIQDITQKLFFL
FT                   QVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKELHKAGYLGSERLIPQRVMDQHKL
FT                   TRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDA
FT                   LGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   QLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQM
FT                   MREKEELMLRLQDYEEKTRKAEKELSDQIQRALKLEEERKRAQEEAGRLEADRLAALRA
FT                   KEELERQAADQIKSQEQLATELAEYTAKIALLEEARRRKENEVEEWQLRAKEAQDDLVK
FT                   TREELHLVMTAPPPPPVYEPVNYHVHEGPQEEGTELSAELSSEGILDDRNEEKRITEAE
FT                   KNERVQRQLMTLTSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRID
FT                   EFEAM"
XX
SQ   Sequence 2720 BP; 718 A; 688 C; 790 G; 524 T; 0 other;
     aagcggcagc gcggggcggg cgccgagtct cggggcggcg gcggcgggag cggcaggagg        60
     actgctgggc acgctcatag ggcttcctcc gcctgcaggt cgggaaaggg cgtttcagct       120
     gctgctggag agcgtgtttc caaggaaggc gagaaaaccc gtccagaacc gaaaatgccg       180
     aaaccgatca acgtccgagt gaccaccatg gatgcggagc tggagtttgc catccagcca       240
     aacaccacag gaaagcagct ttttgatcag gtggttaaga ccatcggcct tagggaagtg       300
     tggtactttg gcctccagta tgtggataac aaaggatttc ctacatggtt gaaacttgat       360
     aaaaaggtgt ccgcccagga ggtcaggaag gagagcccgc tgcagttcaa gttccgggcc       420
     aagttctacc ccgaggacgt ggccgaggag ctcatccagg acatcacgca gaagctcttc       480
     ttcctgcaag tgaaggaggg catcctcagc gacgagatct actgcccgcc cgagaccgcc       540
     gtgctcctgg gctcctacgc cgtgcaggcc aagttcggcg actacaacaa ggagctgcac       600
     aaggcggggt acctcggctc cgagcggctc atcccccaga gagtcatgga ccagcacaag       660
     ctcaccaggg accagtggga ggaccggatc caggtgtggc atgcagaaca ccgcgggatg       720
     ctcaaggaca gcgccatgct ggaatacctg aagatcgccc aggacctgga aatgtacggg       780
     atcaactatt tcgagataaa aaataagaaa ggaacagacc tttggctcgg cgttgatgcc       840
     cttggactaa atatctatga gaaagacgat aagttgaccc caaagattgg cttcccatgg       900
     agcgagatca ggaacatctc tttcaatgac aagaagtttg tcatcaagcc catcgacaag       960
     aaggctcctg acttcgtgtt ctacgccccc cgcctgcgga tcaacaagcg gatcctgcag      1020
     ctctgcatgg ggaaccatga gctgtacatg cgccgccgga agcccgacac cattgaggtg      1080
     cagcagatga aggcccaggc ccgggaggag aagcaccaga agcagctgga gaggcagcag      1140
     ttggaaaccg agaagaagag gagagaaacc gtggagcgag aaaaagagca gatgatgcgt      1200
     gagaaggagg agctgatgct caggcttcag gactacgagg aaaaaaccag gaaggctgag      1260
     aaagagctct ccgaccagat ccagagagcg ctgaagctgg aggaggagag gaagcgggcc      1320
     caggaggagg cggggcgcct ggaggctgac cgcctggccg cgctgcgtgc caaggaggag      1380
     ctggagaggc aggcagccga ccagatcaag agccaggagc agctggccac agagctcgcc      1440
     gagtacaccg ccaagatcgc cctcctggag gaggcacggc ggcgcaagga gaatgaagtg      1500
     gaagagtggc agctccgggc caaggaagcc caggatgacc tggtgaagac ccgggaggag      1560
     ctgcacctgg tgatgaccgc gccgccgccg ccaccggtgt acgagccggt gaactaccac      1620
     gtgcatgagg gcccgcagga ggagggcacg gagctgagcg ccgagctgtc cagcgagggc      1680
     atcctggacg accgcaacga ggagaagcgc atcaccgagg ccgagaagaa cgagcgcgtg      1740
     cagcggcagc tgatgactct gaccagtgag ctgtcccagg ccagagacga gaacaagcgg      1800
     acccacaacg acatcatcca caatgagaac atgaggcaag gccgggacaa gtacaagacg      1860
     ctgcggcaga tccggcaagg caacaccaag cagcgcatcg acgagttcga ggccatgtga      1920
     agggtcgggc ctcggctccg cgcggcggcc agtccgcgcc gccccgcgcc gcccccagcc      1980
     ctcgggccgc caccctctcc ctgctccggg tccttcacca aaagagcagt tgcttcagtg      2040
     ggaatgttct ggggccggga ccggcggcag tttccctggt ttatttttcc caatggtatc      2100
     atagtgccaa acaggcctga ttcttatttt tatttttatt gaatcacttc ctgttttttt      2160
     tttttttgct tggagcagga tgaaatcaat taaggaaaga tgcctataaa gtctgaaata      2220
     actaactcct ccatgctggc atgtgtgata cgagattcag tataattaaa accacatcgt      2280
     ggcttatatt ctgtgccata ctttttttct atctgaaact agccgaaatt gattttcttg      2340
     atttctatga aggatccacc tctgtatatt tgttttttga agggtgaaaa gtttgacgca      2400
     ctccctacgc acacacacca tttccttcct ctgaggcctt cagttcagtt gacaaaatcc      2460
     tgtgatcatt ggatccctca ggataaacaa cgctggatac tgtactctgg ataatttttt      2520
     tttttttttt tgcttaacag gtagagggct acattgttgg actcacacac ctaaataatc      2580
     agctatagag tatagtattt atatgtaagc gataacatgg gtttgtaaca ttagtttaaa      2640
     aaagggaaag tttcattctg tatattttgt taccttttac agaataataa aagaattaca      2700
     tatgaaaaaa aaaaaaaaaa                                                  2720
//

If you have problems or comments...

PBIL Back to PBIL home page