(data stored in ACNUC1829 zone)

EMBL: BC102657

ID   BC102657; SV 1; linear; mRNA; STD; MAM; 883 BP.
XX
AC   BC102657;
XX
DT   13-SEP-2005 (Rel. 85, Created)
DT   16-FEB-2007 (Rel. 90, Last updated, Version 7)
XX
DE   Bos taurus CD63 molecule, mRNA (cDNA clone MGC:127997 IMAGE:30956986),
DE   complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-883
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (15-AUG-2005) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; 3266b70155628be324115e0357939b27.
DR   Ensembl-Gn; ENSBTAG00000011931; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000015829; bos_taurus.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: Y. Meng, M. Taniguchi, L. Guan and S. Moore
CC   cDNA Library Preparation: M. Masaaki, Y. Meng, S. Lobo,  L. Guan
CC   and Dr. S. Moore
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Taniguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Bala M, Barber S, Babakaiff R, Beland J, Chand S, Chun E,
CC   Del Rio L, Gibson S, Kirkpatrick R, Liu J, Matsuo C, Mayo M,
CC   Palmquist D, Santos RR, Stott J, Tsai M, Wong D, Wynhoven B, Hanson
CC   R, Siddiqui A, Holt R, Jones SJ, Marra MA
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 242 Row: h Column: 9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..883
FT                   /organism="Bos taurus"
FT                   /lab_host="ElectroMAX DH10B"
FT                   /strain="Crossbred x Angus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-04"
FT                   /clone="MGC:127997 IMAGE:30956986"
FT                   /tissue_type="Liver, 6 month old female calf, Crossbred x
FT                   Angus"
FT                   /note="Vector: pCMV-SPORT6.0"
FT                   /db_xref="taxon:9913"
FT   gene            1..883
FT                   /gene="CD63"
FT   CDS_pept        66..779
FT                   /codon_start=1
FT                   /gene="CD63"
FT                   /product="CD63 protein"
FT                   /db_xref="GOA:Q9XSK2"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9XSK2"
FT                   /protein_id="AAI02658.1"
FT                   /translation="MAVEGGMKCVKFLLYVLLLVFCACAVGLIAVGVGTHLVLNQTITH
FT                   GATPSFLLPVVIIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAG
FT                   YVFRDKVRSEFNKDFRQQMKNYPKDNQTASILDKMQKDFECCGAANYTDWEKILAVTNK
FT                   VPDSCCVNITHNCGINFVVKDIHTEGCVEKIAAWLRKNVLVVAAAALGIAFVEILGIVL
FT                   ACCLVKSIRSGYEVM"
XX
SQ   Sequence 883 BP; 203 A; 202 C; 256 G; 222 T; 0 other;
     gagagagccc ctgagcagcg gcgggagagc agcacacagc ctccgggagc ccaggccagg        60
     cagccatggc ggtggaagga ggaatgaaat gtgtcaagtt tctgctctac gttctcctgc       120
     tggtcttctg cgcctgtgcg gtgggactga ttgctgtggg cgtagggacc cacctcgtcc       180
     tgaatcagac tatcacccat ggggccaccc ctagtttcct gttgcctgtg gtcatcatcg       240
     cagtgggggc cttcctcttc ctggtggcct ttgtgggctg ctgtggagcc tgcaaggaga       300
     actactgtct tatgatcaca tttgccatct tcttgtccct tatcatgcta gttgaagtgg       360
     ctgcagccat tgctggctat gtgtttagag acaaggtgag atcagaattt aataaggact       420
     tccggcagca gatgaagaat tatccaaaag acaaccagac ggcatcgatc ctggataaga       480
     tgcagaaaga ttttgagtgc tgcggggcgg ctaactacac agactgggag aagatcctgg       540
     ccgtgaccaa taaagtccct gactcctgct gcgtcaatat cactcataac tgtgggatta       600
     atttcgttgt gaaggacatc catactgagg gctgtgtgga gaagattgcg gcctggctga       660
     ggaagaatgt gctggtggtg gctgcggcag ccctaggcat tgcctttgtg gagatcctgg       720
     gtattgtctt agcatgctgc cttgtgaaga gcatccgaag tggctatgag gtgatgtagg       780
     gggtctgtct cttcagcccc ctcatccagg ggagtggggt aatatactcc aggtttttca       840
     attaaacgga ttattttttc agaccccaaa aaaaaaaaaa aaa                         883
//

If you have problems or comments...

PBIL Back to PBIL home page