(data stored in ACNUC16935 zone)

EMBL: BC103477

ID   BC103477; SV 1; linear; mRNA; STD; ROD; 1501 BP.
XX
AC   BC103477;
XX
DT   23-AUG-2005 (Rel. 84, Created)
DT   11-DEC-2005 (Rel. 86, Last updated, Version 2)
XX
DE   Rattus norvegicus ubiquitin C, mRNA (cDNA clone MGC:124622 IMAGE:7929586),
DE   complete cds.
XX
KW   MGC.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1501
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1501
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (21-AUG-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b948b83229efedb0a7b596a897e69b9b.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeff Green/Paturu Kondaiah, NCI.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 243 Row: d Column: 21
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 8394501.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1501
FT                   /organism="Rattus norvegicus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Pr49"
FT                   /clone="MGC:124622 IMAGE:7929586"
FT                   /tissue_type="Prostate, pool of NCI_CGAP_Pr30, 40, 41 and
FT                   NCI_CGAP_Pr29, 39, 42"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:10116"
FT   gene            1..1501
FT                   /gene="Ubc"
FT   CDS_pept        59..1351
FT                   /codon_start=1
FT                   /gene="Ubc"
FT                   /product="Ubc protein"
FT                   /db_xref="GOA:Q63429"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:5L9U"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63429"
FT                   /protein_id="AAI03478.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI
FT                   PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEP
FT                   SVNTKKVKQEDTRTFLTTVSRKSPSCACSWV"
XX
SQ   Sequence 1501 BP; 452 A; 409 C; 370 G; 270 T; 0 other;
     cgagaccgcc agttccgtct ctactctttt gtgaggactg cagccaacac cgctgacaat        60
     gcagatcttt gtgaaaacct taactggtaa gaccatcacc ctggaggtcg agcccagtga       120
     caccattgaa aatgtcaagg caaagatcca ggacaaggag ggcatccccc ctgaccagca       180
     gaggctgatc tttgcaggca agcagctgga agatggccgc accctgtcag actacaacat       240
     ccagaaggag tccaccttgc acctggtcct tcgcctcaga gggggcatgc agatctttgt       300
     gaagaccctg acaggcaaga ccatcaccct ggaggtcgag cccagtgaca ccattgaaaa       360
     tgtcaaggca aagatccagg acaaggaggg catcccccct gaccagcaga ggctgatctt       420
     tgcaggcaag cagctggaag atggccgcac cctgtcagac tacaacatcc agaaggagtc       480
     caccctgcac ctggtccttc gcctcagagg gggcatgcag atctttgtga agaccctgac       540
     aggcaagacc atcaccctgg aggtcgagcc cagtgacacc attgaaaatg tcaaggcaaa       600
     gatccaggac aaggagggca tcccccctga ccagcagagg ctgatctttg caggcaagca       660
     gctggaagat ggccgcaccc tgtcagacta caacatccag aaggagtcca ccctgcacct       720
     ggtccttcgc ctcagagggg gcatgcagat ctttgtgaag accctgacag gcaagaccat       780
     caccctggag gtcgagccca gtgacaccat tgaaaatgtc aaggcaaaga tccaggacaa       840
     ggagggcatc ccccctgacc agcagaggct gatctttgca ggcaagcagc tggaagatgg       900
     ccgcaccctg tcagactaca acatccagaa ggagtccacc ctgcacctgg tccttcgcct       960
     cagagggggc atgcagatct ttgtgaagac cctgacaggc aagaccatca ccctggaggt      1020
     cgagcccagt gacaccattg aaaatgtcaa ggcaaagatc caggacaagg agggcatccc      1080
     ccctgaccag cagaggctga tctttgcagg caagcagctg gaagatggcc gcaccctgtc      1140
     agactacaac atccagaagg agtccaccct gcacctggtc cttcgcctca gagggggcat      1200
     gcagatcttt gtgaagaccc tgacaggcaa gaccatcact ctggatgtcg agcccagtgt      1260
     taacaccaag aaggtcaaac aggaagatac tcgtaccttt ctcaccacag tatctagaaa      1320
     gagcccttct tgtgcttgtt cttgggtttg atggggaggt gtcttagttt tccctatctt      1380
     ttaagctgtt aacaagtttc attgcacttt gaataaagtt cttgcattcc caaaaaaaaa      1440
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1500
     a                                                                      1501
//

If you have problems or comments...

PBIL Back to PBIL home page