(data stored in ACNUC23059 zone)

EMBL: BC103772

ID   BC103772; SV 1; linear; mRNA; STD; MUS; 1201 BP.
XX
AC   BC103772;
XX
DT   15-SEP-2005 (Rel. 85, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus CDK2 (cyclin-dependent kinase 2)-associated protein 1, mRNA
DE   (cDNA clone IMAGE:6476229), complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1201
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1201
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (07-SEP-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 9c87c42d91cb0a91057d0db9a420f711.
DR   Ensembl-Gn; ENSMUSG00000029394; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078154; mus_musculus.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029786; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030522; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029893; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030563; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028909; mus_musculus_pwkphj.
DR   Ensembl-Tr; ENSMUST00000031341; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000104959; mus_musculus.
DR   Ensembl-Tr; MGP_C3HHeJ_T0074066; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0074898; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0074061; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0075131; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0074064; mus_musculus_pwkphj.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 232 Row: k Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 49355793
CC   This clone has the following problem: The cds is short compared to
CC   the longest cds in the locus.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1201
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Co24"
FT                   /clone="IMAGE:6476229"
FT                   /tissue_type="Colon, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1201
FT                   /gene="Cdk2ap1"
FT                   /note="synonyms: ST19, DORC1, doc-1, Apc10, Cdkap1"
FT   CDS_pept        160..504
FT                   /codon_start=1
FT                   /gene="Cdk2ap1"
FT                   /product="CDK2 (cyclin-dependent kinase 2)-associated
FT                   protein 1"
FT                   /db_xref="GOA:O35207"
FT                   /db_xref="InterPro:IPR017266"
FT                   /db_xref="MGI:MGI:1202069"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35207"
FT                   /protein_id="AAI03773.1"
FT                   /translation="MSYKPNLTAHMPAAALNAGSVHSPSTSMATSSQYRQLLSDYGPPS
FT                   LGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVREC
FT                   LAETERNARS"
FT   misc_difference 306
FT                   /gene="Cdk2ap1"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1153..1201
FT                   /gene="Cdk2ap1"
FT                   /note="polyA tail: 49 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1201 BP; 310 A; 334 C; 299 G; 258 T; 0 other;
     gcggcccgag ccggcgacaa caaaaagtgc gcgggctccc ggcgggcgct cggacggctg        60
     cggggacgtg gggccgcccg gcccgggcct cggcctcggc ctcgccggcg cgctcgcggc       120
     ctggcccggc tctgcccggc gcgcccgccg cccgcgggga tgtcgtacaa gccgaacttg       180
     accgcgcaca tgcccgccgc cgccctcaac gccggaagtg tccactcacc ctctactagc       240
     atggcgacct cctcccaata tcgccagctg ctgagtgact atgggcctcc atcgctaggc       300
     tacactcagg gaactggaaa tagccaggtg cctcagagta aatatgcaga gctgctggcc       360
     atcattgaag agttggggaa agagatcaga ccgacgtatg cagggagcaa gagcgccatg       420
     gagaggctaa aacgaggcat cattcatgcc cggagcctgg ttcgggagtg cttggctgaa       480
     acggaacgga atgccaggtc ctagcccctg gctggtctga aggcccatct cactaccccg       540
     tggagatgag aggctttgtg caaaatggca gtcatttttc taccacagtc attaagctct       600
     gaacccacac tcaaaagatt gggaggacat tttgcagtaa ctgacgatgt gcattttaag       660
     tagttaggaa tgacccagct ctttttttct ttccaaacat ttgaaagatg tttgtgaagc       720
     cacttcacag caagctattg tttgtcccca aataccagtg tcccctctaa cctgcctttg       780
     gatacgcatc accccagctg acttcctttc cctgagctca cctgcctccg aggagttgag       840
     tgcaaaccac agcgcctttg ctcagtagct ggcccgcctg tgtacagtgt agaccctgct       900
     tcatggagct tctctgccta agcgtttgca tgactgagtg cttggaagtc aatctttaaa       960
     atgcacaggt tacacatgca gaagaaagag ccatctaccc aacctcccaa gcaccctgca      1020
     gatgtccatc ctgaggctgt agatctcagt tctgtgttta ctgtgagccc atcacaacat      1080
     ctggaagaaa gcgactgaaa ctgttgcatc tttgtattta ttacttgatg taataaagct      1140
     tattttcatt aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1200
     a                                                                      1201
//

If you have problems or comments...

PBIL Back to PBIL home page