(data stored in ACNUC15260 zone)

EMBL: BC104078

ID   BC104078; SV 1; linear; mRNA; STD; MUS; 939 BP.
XX
AC   BC104078;
XX
DT   21-SEP-2005 (Rel. 85, Created)
DT   21-MAR-2007 (Rel. 91, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor 1416, mRNA (cDNA clone IMAGE:40042051),
DE   partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-939
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-939
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (07-SEP-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; bdd22b16ed353e43fd8caf3d3434f807.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 10 Row: d Column: 17.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..939
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="IMAGE:40042051"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: TGTATAT sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            <1..939
FT                   /gene="Olfr1416"
FT                   /note="synonym: MOR103-3"
FT   misc_feature    1..939
FT                   /gene="Olfr1416"
FT                   /note="This cDNA sequence aligns to the mouse C57BL/6J
FT                   genome (build 36) without differences"
FT   CDS_pept        <1..938
FT                   /codon_start=3
FT                   /gene="Olfr1416"
FT                   /product="Olfr1416 protein"
FT                   /db_xref="GOA:Q3MI73"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031250"
FT                   /db_xref="UniProtKB/TrEMBL:Q3MI73"
FT                   /protein_id="AAI04079.1"
FT                   /translation="RGENITKVSTFILLGFPTAPELQYLLFLLFLLAYLFVLVENLTII
FT                   LTVWSSASLHRPMYYFLGSLSFLEIWYVSDIIPKMLDGFLLQRKRISFIGCMTQLYFFS
FT                   SLVCTECVLLASMAYDRYVAICHPLRYQVIMTTGLCVQLVAFSFASGFTISVIKVYFIS
FT                   SATFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFPLLATILSYGHITL
FT                   AVLRIPSATGRWRAFSTCASHLTVVTFFYMAMIFMYVRPQAIDTRSSNKLISAVYTVLT
FT                   PMMNPLIYCLRNTEFKDAVRRTLGLGNTPQ"
XX
SQ   Sequence 939 BP; 174 A; 302 C; 196 G; 267 T; 0 other;
     tgagggggga gaacatcacc aaggtcagca ccttcatcct gctgggcttc cccacagccc        60
     ctgagctgca atacctgctc ttcctcctct tcctgctcgc ctacctcttt gtgctggtgg       120
     agaacctgac catcatcctc actgtctgga gcagcgcctc cctccacaga cccatgtact       180
     acttcctggg atccttgtct ttcctagaga tctggtatgt gtcagacatc atccccaaaa       240
     tgctggatgg cttcctcttg cagaggaaac gcatctcttt cattggatgc atgactcagc       300
     tctacttctt cagctccctg gtatgtacag agtgtgtact cctggcttcc atggcctatg       360
     accgctatgt ggccatctgc caccccctgc gctaccaagt catcatgacc acagggctgt       420
     gtgtccagct tgtggccttc tcttttgcta gtggcttcac catctctgtg attaaggtct       480
     actttatctc cagcgccacc ttctgtggct ccaatgtctt gaaccacttc ttctgtgaca       540
     tctcccccat cctcaagctg gcctgcactg acttctctac tgcagagctg gtggacttca       600
     tcctggcctt catcattctg gtgttcccac tcttggccac cattctctcc tatggccaca       660
     tcaccctggc tgtgctgcgc atcccttcag ccacaggccg gtggagagcc ttctccacct       720
     gtgcttccca cctcactgtg gtcaccttct tctacatggc catgatcttc atgtatgtgc       780
     gaccccaggc cattgatacc cggagctcca acaagctcat ctctgctgtg tacaccgtcc       840
     tcacgcccat gatgaatcct ttgatctact gtctgaggaa tactgaattt aaggatgctg       900
     tgagaagaac tttgggattg ggaaatactc cccagtaga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page