(data stored in ACNUC7820 zone)

EMBL: BC104112

ID   BC104112; SV 1; linear; mRNA; STD; MUS; 961 BP.
XX
AC   BC104112;
XX
DT   15-SEP-2005 (Rel. 85, Created)
DT   05-OCT-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Mus musculus olfactory receptor 1351, mRNA (cDNA clone MGC:123826
DE   IMAGE:40043939), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-961
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-961
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (07-SEP-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3a006e4474a27558410cce6e4ecbae53.
DR   Ensembl-Gn; ENSMUSG00000063216; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017437; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017415; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017378; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017377; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017200; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017832; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016770; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017172; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017280; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017272; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017349; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017299; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017872; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016551; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016829; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000080730; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216030; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026016; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0025992; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0025958; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025961; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025767; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026452; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025334; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0025691; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0025820; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0025816; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0025930; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025812; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026500; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025043; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025304; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 10 Row: h Column: 3.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..961
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:123826 IMAGE:40043939"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: GGTATTT sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..961
FT                   /gene="Olfr1351"
FT                   /note="synonym: MOR139-4"
FT   CDS_pept        1..960
FT                   /codon_start=1
FT                   /gene="Olfr1351"
FT                   /product="olfactory receptor 1351"
FT                   /db_xref="GOA:Q8VGU6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031185"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGU6"
FT                   /protein_id="AAI04113.1"
FT                   /translation="MEPGNDTQLSEFFLLELSENQPQIQPLIFGLFLSMYLVTVTGNLL
FT                   IIMAITADSHLHTPMYIFLSNLSFVDICFTSTTVPQMLVTIHTQSKAITYANCITQVYF
FT                   LLLFSVLDIFLLTVMAYDHYVAICHPLHYMIIMNTRRCGLMILACWIIGVINSLLHTFL
FT                   ALRLSFCTDLEIPHFYCELNQVVHHACSDISLNDMVIYIAAMLLVVGPLSGILYSYSKI
FT                   VSSICAISSVQGKYKAFSTCASHLSVVSLFYCTLLGVYLSSAVTQNAQATALASLMYTV
FT                   VTPMLNPFIYSLRNNDMKKALKIVLGRVTRNRLTDLPS"
FT   misc_difference 961
FT                   /gene="Olfr1351"
FT                   /note="1 base at the 3' end does not align to the mouse
FT                   genome."
XX
SQ   Sequence 961 BP; 235 A; 254 C; 173 G; 299 T; 0 other;
     atggaaccag gaaatgacac tcagctttca gaattctttc ttctggaatt atcagagaat        60
     caacctcaaa ttcagcctct catatttgga ctgttccttt ccatgtacct agtgactgtc       120
     actggaaacc tactcatcat catggccatc actgccgact cccacctgca cacacccatg       180
     tacatcttcc tctctaatct gtcctttgtg gacatctgct ttacttccac cactgttcca       240
     cagatgctgg tgaccattca cacacagagc aaggccatca cctatgcaaa ctgcatcacc       300
     caggtatact ttttactact tttttcggta ctggacatct ttctgctgac tgtgatggcc       360
     tatgaccact atgtggccat ctgtcacccc ctgcattaca tgatcatcat gaacacaaga       420
     cgctgtggat tgatgattct ggcatgctgg attataggtg ttataaattc cctgttacac       480
     acctttttgg cattacggct gtcattctgc acagacctgg agatccctca cttttactgt       540
     gaacttaatc aagttgtaca ccatgcctgt tctgacatct ctcttaatga catggtgatt       600
     tacattgcag ctatgctact ggttgtggga cccctctctg gtatccttta ctcttactct       660
     aagatagtgt cctccatttg tgcaatctcc tcagtgcagg ggaagtacaa agcattttcc       720
     acctgtgcat ctcacctctc agttgtctcc ttattttatt gtaccctcct gggagtgtac       780
     ctcagttctg ctgtgactca aaatgcacag gccactgcat tggcttcact gatgtacact       840
     gtggtcaccc ccatgctgaa cccattcatc tatagtttaa ggaataatga catgaaaaag       900
     gctctgaaaa tagttttagg gagggtaact agaaacagac taacggactt accttcttag       960
     g                                                                       961
//

If you have problems or comments...

PBIL Back to PBIL home page