(data stored in ACNUC7820 zone)

EMBL: BC104113

ID   BC104113; SV 1; linear; mRNA; STD; MUS; 960 BP.
XX
AC   BC104113;
XX
DT   21-SEP-2005 (Rel. 85, Created)
DT   21-MAR-2007 (Rel. 91, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor 1351, mRNA (cDNA clone IMAGE:40043940),
DE   partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-960
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-960
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (07-SEP-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7d67b549475395eae21fc91e71eb3cdb.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 10 Row: h Column: 4.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..960
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="IMAGE:40043940"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: ATACTTA sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            <1..960
FT                   /gene="Olfr1351"
FT                   /note="synonym: MOR139-4"
FT   CDS_pept        <1..959
FT                   /codon_start=3
FT                   /gene="Olfr1351"
FT                   /product="Olfr1351 protein"
FT                   /db_xref="GOA:Q3MI62"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3MI62"
FT                   /protein_id="AAI04114.1"
FT                   /translation="EPGNDTQLSEFFLLELSENQPQIQPLIFGLFLSMYLVTVTGNLLI
FT                   IMAITADSHLHTPMYIFLSNLSFVDICFTSTTVPQMLVTIHTQSKAITYANCITQVYFL
FT                   LLFSVLDIFLLTVMAYDHYVAICHPLHYMIIMNTRRCGLMILACWIIGVINSLLHTFLA
FT                   LRLSFCTDLEIPHFYCELNQVVHHACSDISLNDMVIYIAAMLLVVGPLSGILYSYSKIV
FT                   SSICAISSVQGKYKAFSTCASHLSVVSLFYCTLLGVYLSSAVTQNAQATALASLMYTVV
FT                   TPMLNPFIYSLRNNDMKKALKIVLGRVTRNRLTDLPS"
FT   misc_difference 960
FT                   /gene="Olfr1351"
FT                   /note="1 base at the 3' end does not align to the mouse
FT                   genome."
XX
SQ   Sequence 960 BP; 234 A; 254 C; 173 G; 299 T; 0 other;
     tggaaccagg aaatgacact cagctttcag aattctttct tctggaatta tcagagaatc        60
     aacctcaaat tcagcctctc atatttggac tgttcctttc catgtaccta gtgactgtca       120
     ctggaaacct actcatcatc atggccatca ctgccgactc ccacctgcac acacccatgt       180
     acatcttcct ctctaatctg tcctttgtgg acatctgctt tacttccacc actgttccac       240
     agatgctggt gaccattcac acacagagca aggccatcac ctatgcaaac tgcatcaccc       300
     aggtatactt tttactactt ttttcggtac tggacatctt tctgctgact gtgatggcct       360
     atgaccacta tgtggccatc tgtcaccccc tgcattacat gatcatcatg aacacaagac       420
     gctgtggatt gatgattctg gcatgctgga ttataggtgt tataaattcc ctgttacaca       480
     cctttttggc attacggctg tcattctgca cagacctgga gatccctcac ttttactgtg       540
     aacttaatca agttgtacac catgcctgtt ctgacatctc tcttaatgac atggtgattt       600
     acattgcagc tatgctactg gttgtgggac ccctctctgg tatcctttac tcttactcta       660
     agatagtgtc ctccatttgt gcaatctcct cagtgcaggg gaagtacaaa gcattttcca       720
     cctgtgcatc tcacctctca gttgtctcct tattttattg taccctcctg ggagtgtacc       780
     tcagttctgc tgtgactcaa aatgcacagg ccactgcatt ggcttcactg atgtacactg       840
     tggtcacccc catgctgaac ccattcatct atagtttaag gaataatgac atgaaaaagg       900
     ctctgaaaat agttttaggg agggtaacta gaaacagact aacggactta ccttcttagg       960
//

If you have problems or comments...

PBIL Back to PBIL home page