(data stored in ACNUC15465 zone)

EMBL: BC104951

ID   BC104951; SV 1; linear; mRNA; STD; HUM; 465 BP.
XX
AC   BC104951;
XX
DT   22-JAN-2006 (Rel. 86, Created)
DT   19-MAR-2009 (Rel. 100, Last updated, Version 55)
XX
DE   Homo sapiens G antigen 12I, mRNA (cDNA clone MGC:132611 IMAGE:8143954),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-465
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-465
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-SEP-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3787a9b32656c8b93cf7b02b5fecfcff.
DR   Ensembl-Gn; ENSG00000215269; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236362; homo_sapiens.
DR   Ensembl-Tr; ENST00000440137; homo_sapiens.
DR   Ensembl-Tr; ENST00000445148; homo_sapiens.
DR   Ensembl-Tr; ENST00000639028; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Mike Brownstein, NIMH
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCB Plate: 3 Row: i Column: 8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..465
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_327"
FT                   /clone="MGC:132611 IMAGE:8143954"
FT                   /tissue_type="Lung and placenta, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: GCCCGCGC"
FT                   /db_xref="taxon:9606"
FT   gene            1..465
FT                   /gene="GAGE12I"
FT                   /gene_synonym="AL4"
FT                   /gene_synonym="CT4.7"
FT   misc_feature    1..465
FT                   /gene="GAGE12I"
FT                   /gene_synonym="AL4"
FT                   /gene_synonym="CT4.7"
FT                   /note="; This cDNA sequence aligns to the human reference
FT                   genome (build 36) without differences"
FT   CDS_pept        82..435
FT                   /codon_start=1
FT                   /gene="GAGE12I"
FT                   /gene_synonym="AL4"
FT                   /gene_synonym="CT4.7"
FT                   /product="G antigen 12I"
FT                   /db_xref="GOA:O76087"
FT                   /db_xref="H-InvDB:HIT000338039_09.4"
FT                   /db_xref="HGNC:HGNC:4104"
FT                   /db_xref="InterPro:IPR008625"
FT                   /db_xref="InterPro:IPR031320"
FT                   /db_xref="UniProtKB/Swiss-Prot:O76087"
FT                   /protein_id="AAI04952.1"
FT                   /translation="MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGE
FT                   PATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEE
FT                   VKTPEEGEKQSQC"
XX
SQ   Sequence 465 BP; 128 A; 101 C; 147 G; 89 T; 0 other;
     gccagggagc tgtgaggcag tgctgtgtgg ttcctgccgt ccggactctt tttcctctac        60
     tgagattcat ctgtgtgaaa tatgagttgg cgaggaagat cgacctatta ttggcctaga       120
     ccaaggcgct atgtacagcc tcctgaaatg attgggccta tgcggcccga gcagttcagt       180
     gatgaagtgg aaccagcaac acctgaagaa ggggaaccag caactcaacg tcaggatcct       240
     gcagctgctc aggagggaga ggatgaggga gcatctgcag gtcaagggcc gaagcctgaa       300
     gctcatagcc aggaacaggg tcacccacag actgggtgtg agtgtgaaga tggtcctgat       360
     gggcaggaga tggacccgcc aaatccagag gaggtgaaaa cgcctgaaga aggtgaaaag       420
     caatcacagt gttaaaagaa gacacgttga aatgatgcag gctgc                       465
//

If you have problems or comments...

PBIL Back to PBIL home page