(data stored in ACNUC23390 zone)

EMBL: BC106383

ID   BC106383; SV 1; linear; mRNA; STD; VRT; 1808 BP.
XX
AC   BC106383;
XX
DT   02-OCT-2005 (Rel. 85, Created)
DT   02-OCT-2005 (Rel. 85, Last updated, Version 1)
XX
DE   Xenopus laevis cDNA clone MGC:130958 IMAGE:7974381, complete cds.
XX
KW   MGC.
XX
OS   Xenopus laevis (African clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus.
XX
RN   [1]
RP   1-1808
RX   DOI; 10.1002/dvdy.10174.
RX   PUBMED; 12454917.
RA   Klein S.L., Strausberg R.L., Wagner L., Pontius J., Clifton S.W.,
RA   Richardson P.;
RT   "Genetic and genomic tools for Xenopus research: The NIH Xenopus
RT   initiative";
RL   Dev. Dyn. 225(4):384-391(2002).
XX
RN   [2]
RP   1-1808
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [3]
RC   NIH-MGC Project
RP   1-1808
RA   Klein S., Gerhard D.S.;
RT   ;
RL   Submitted (01-OCT-2005) to the INSDC.
RL   National Institutes of Health, Xenopus Gene Collection (XGC), National
RL   Institute of Child Health and Human Development, 6100 Executive Boulevard,
RL   Room 4B01, Rockville, MD 20892-7510, USA
XX
DR   MD5; 8ab2d340a5d8d727e3302d3a52a94e73.
XX
CC   Contact: XGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Igor Dawid
CC   cDNA Library Preparation: Express Genomics
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 254 Row: d Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis, Similarity but not identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1808
FT                   /organism="Xenopus laevis"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NICHD_XGC_Emb9"
FT                   /clone="MGC:130958 IMAGE:7974381"
FT                   /tissue_type="Embryo, neurula stage"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:8355"
FT   CDS_pept        322..1341
FT                   /codon_start=1
FT                   /product="Unknown (protein for MGC:130958)"
FT                   /db_xref="GOA:Q3KQ52"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KQ52"
FT                   /protein_id="AAI06384.1"
FT                   /translation="MEKSKNFRIDALLAIDPPKAQTSPLALVTSLSSSSLSNSGSPPSE
FT                   HTDSLRTDSPSPPRTCGLVPKPGFLNSHQHPPNMMSLHPQVVPGIPPQALYGHPMYSYS
FT                   AAAALGQHPALSYPYSHIQGTHHAHPMDPIKISAGTFQLDQWLRASTAGMMLPKMSDFN
FT                   SQAQSNLLGKCRRPRTAFTSQQLLELEHQFKVNKYLSRPKRFEVATSLMLTETQVKIWF
FT                   QNRRMKWKRSKKAKEQAAQDSAEKKQRGGKVSCEEKCSDELQGEKKPYHLHSRGEPIKC
FT                   NGRLQPRDYTDSEEEEEDREEEEEEGHRGEGKRFYHHSSDCTSEEEEEDNSHNKQNGL"
XX
SQ   Sequence 1808 BP; 505 A; 519 C; 435 G; 349 T; 0 other;
     ccggagcctc atacctgcgc tgctctcacc tcgtgccact gctgagcctc acatctccga        60
     cctcgttatt ctcaggggcc acagcaccaa gcaccgcgct cacaaggaga accacagcct       120
     tgcagagctg acccgggaag cgcagagcca gacacagcgc agagcgcaca ttagcgcatg       180
     aaacaggagc actttgtatc cgcaggacac agtatcgcag cgagttgagc gcagaggatt       240
     cccagctgtt tgctacacaa atactcacgg cttcccacca tcaccccgcg gggaacatac       300
     ggctggaggg gcgcagagct catggagaag tccaagaatt tccggattga cgctcttttg       360
     gcaatagacc cccccaaggc tcagacctcc ccattggctc tggtcacctc gttgtcctcc       420
     tcatctctct ccaactctgg cagcccccca tccgagcaca ctgacagcct caggactgac       480
     tccccctccc ctccaaggac ttgtggactg gtccccaaac caggtttcct caacagccac       540
     cagcaccccc ctaacatgat gtctttgcac ccccaagttg ttccagggat cccccctcag       600
     gccctgtatg gacacccaat gtacagctac tcagcagcag cggccctggg gcagcaccca       660
     gctctgtcct acccctactc ccacatacag ggcacccatc atgcccaccc tatggacccc       720
     atcaagatca gcgctggcac cttccaactg gaccagtggc tcagagcctc cactgctgga       780
     atgatgttgc ccaaaatgtc agactttaac tcccaggccc aatctaactt gctgggaaag       840
     tgcagaagac caaggacagc gtttaccagt cagcagctct tggaactgga gcaccaattc       900
     aaggtgaaca agtacctctc caggccgaaa cgctttgaag tggccacttc cctgatgttg       960
     actgagacgc aggtgaagat ctggttccag aacaggcgca tgaaatggaa gaggagtaaa      1020
     aaagccaagg agcaggcggc gcaggactca gcagagaaaa agcagagggg aggcaaagtc      1080
     agctgtgagg agaagtgctc ggatgagctg cagggagaga agaaacccta ccatctacac      1140
     tccagggggg agccaataaa atgcaatggc cgcctgcagc ccagagacta tacggacagt      1200
     gaagaggagg aagaggacag ggaagaggag gaagaggaag ggcacagagg ggaggggaag      1260
     cggttttatc atcattcttc tgactgcaca tccgaggagg aggaggagga caacagtcac      1320
     aataagcaga acggcctctg agacacatca ttgtcctccc cctaaagaga actgtgttac      1380
     acgagacatg tcatcattgt gttgtgttag tgcgacccta catgcttggt cgaccccagg      1440
     cactcaaact ggataatcac tgtccattcc agcacctcgg agagctccca gtcccagcac      1500
     tgcctgttgc cccctacact gactcttccc tggggggcac atgttcccag gcagggtcat      1560
     gggagttaca cagactactg ggagtccccc cacttcgtgt tcaccaggaa atctgctgga      1620
     cacctgaagg ctacactata tgctgtcttt atttttgtac attgtattta taagagaaat      1680
     agctctacat atgcatgata aattattatt tagctccctc catcataacg atgggatgta      1740
     aaataaattt tgttttgtac ttgtaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1800
     aaaaaaaa                                                               1808
//

If you have problems or comments...

PBIL Back to PBIL home page