(data stored in ACNUC31108 zone)

EMBL: BC106752

ID   BC106752; SV 1; linear; mRNA; STD; HUM; 1045 BP.
XX
AC   BC106752;
XX
DT   04-OCT-2005 (Rel. 85, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens CD37 molecule, mRNA (cDNA clone MGC:120234 IMAGE:40023348),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1045
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1045
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 905591dfb0b51b30154b61ecbbc42043.
DR   Ensembl-Gn; ENSG00000104894; homo_sapiens.
DR   Ensembl-Tr; ENST00000323906; homo_sapiens.
DR   Ensembl-Tr; ENST00000426897; homo_sapiens.
DR   Ensembl-Tr; ENST00000598095; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 13 Row: e Column: 6.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genome
CC   (build 1).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1045
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_283"
FT                   /clone="MGC:120234 IMAGE:40023348"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: AGTTATAT sequenced from
FT                   the forward primer"
FT                   /db_xref="taxon:9606"
FT   gene            1..1045
FT                   /gene="CD37"
FT                   /note="synonyms: TSPAN26, GP52-40"
FT   CDS_pept        39..884
FT                   /codon_start=1
FT                   /gene="CD37"
FT                   /product="CD37 molecule"
FT                   /db_xref="GOA:P11049"
FT                   /db_xref="H-InvDB:HIT000338495.9"
FT                   /db_xref="HGNC:HGNC:1666"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P11049"
FT                   /protein_id="AAI06753.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVS
FT                   FVGLAFVPLQIWSKVLAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQ
FT                   VLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAE
FT                   SHIYREGCAQGLQKWLHNNLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR
FT                   "
FT   misc_difference 152
FT                   /gene="CD37"
FT                   /note="'C' in cDNA is 'T' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the cDNA
FT                   sequence, suggesting that this difference is unlikely to be
FT                   due to an artifact."
XX
SQ   Sequence 1045 BP; 182 A; 353 C; 275 G; 235 T; 0 other;
     ctgtgtggtg agtggaccgc ttaccccact aggtgaagat gtcagcccag gagagctgcc        60
     tcagcctcat caagtacttc ctcttcgttt tcaacctctt cttcttcgtc ctcggcagcc       120
     tgatcttctg cttcggcatc tggatcctca tcgacaagac cagcttcgtg tcctttgtgg       180
     gcttggcctt cgtgcctctg cagatctggt ccaaagtcct ggccatctca ggaatcttca       240
     ccatgggcat cgccctcctg ggttgtgtgg gggccctcaa ggagctccgc tgcctcctgg       300
     gcctgtattt tgggatgctg ctgctcctgt ttgccacaca gatcaccctg ggaatcctca       360
     tctccactca gcgggcccag ctggagcgaa gcttgcggga cgtcgtagag aaaaccatcc       420
     aaaagtacgg caccaacccc gaggagaccg cggccgagga gagctgggac tatgtgcagt       480
     tccagctgcg ctgctgcggc tggcactacc cgcaggactg gttccaagtc ctcatcctga       540
     gaggtaacgg gtcggaggcg caccgcgtgc cctgctcctg ctacaacttg tcggcgacca       600
     acgactccac aatcctagat aaggtgatct tgccccagct cagcaggctt ggacacctgg       660
     cgcggtccag acacagtgca gacatctgcg ctgtccctgc agagagccac atctaccgcg       720
     agggctgcgc gcagggcctc cagaagtggc tgcacaacaa ccttatttcc atagtgggca       780
     tttgcctggg cgtcggccta ctcgagctcg ggttcatgac gctctcgata ttcctgtgca       840
     gaaacctgga ccacgtctac aaccggctcg ctcgataccg ttaggccccg ccctccccaa       900
     agtcccgccc cgcccccgtc acgtgcgctg ggcacttccc tgctgcctgt aaatatttgt       960
     ttaatcccca gttcgcctgg agccctccgc cttcacattc ccctggggac ccacgtggct      1020
     gcgtgcccct gctgctgtca cctct                                            1045
//

If you have problems or comments...

PBIL Back to PBIL home page