(data stored in ACNUC26462 zone)

EMBL: BC106755

ID   BC106755; SV 2; linear; mRNA; STD; HUM; 1385 BP.
XX
AC   BC106755;
XX
DT   04-OCT-2005 (Rel. 85, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens calcium/calmodulin-dependent protein kinase I, mRNA (cDNA
DE   clone MGC:120318 IMAGE:40024363), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1385
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1385
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 08bd721529311e425066fbd6f8324c34.
DR   Ensembl-Gn; ENSG00000134072; homo_sapiens.
DR   Ensembl-Tr; ENST00000256460; homo_sapiens.
XX
CC   On Oct 4, 2006 this sequence version replaced gi:76825090.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 13 Row: f Column: 18.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1385
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_283"
FT                   /clone="MGC:120318 IMAGE:40024363"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: GTGTAA sequenced from
FT                   the forward primer"
FT                   /db_xref="taxon:9606"
FT   gene            1..1385
FT                   /gene="CAMK1"
FT                   /note="synonym: CAMKI"
FT   CDS_pept        147..1259
FT                   /codon_start=1
FT                   /gene="CAMK1"
FT                   /product="calcium/calmodulin-dependent protein kinase I"
FT                   /db_xref="GOA:Q14012"
FT                   /db_xref="H-InvDB:HIT000338498.9"
FT                   /db_xref="HGNC:HGNC:1459"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:4FG7"
FT                   /db_xref="PDB:4FG8"
FT                   /db_xref="PDB:4FG9"
FT                   /db_xref="PDB:4FGB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14012"
FT                   /protein_id="AAI06756.1"
FT                   /translation="MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKL
FT                   VAIKCIAKEALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELF
FT                   DRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDF
FT                   GLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDEN
FT                   DAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTA
FT                   LDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTP
FT                   VAGGPAAGCCCRDCCVEPGTELSPTLPHQL"
XX
SQ   Sequence 1385 BP; 298 A; 397 C; 430 G; 260 T; 0 other;
     ctccagcaag agcgcgggcg ggtggcccag gcacgcagcg gtgaggaccg cggccacagc        60
     tcggcgccaa ccaccgcggg cctcccagcc agccccgcgg cggggcagcc gcaggagccc       120
     tggctgtggt cggggggcag tgggccatgc tgggggcagt ggaaggcccc aggtggaagc       180
     aggcggagga cattagagac atctacgact tccgagatgt tctgggcacg ggggccttct       240
     cggaggtgat cctggcagaa gataagagga cgcagaagct ggtggccatc aaatgcattg       300
     ccaaggaggc cctggagggc aaggaaggca gcatggagaa tgagattgct gtcctgcaca       360
     agatcaagca ccccaacatt gtagccctgg atgacatcta tgagagtggg ggccacctct       420
     acctcatcat gcagctggtg tcgggtgggg agctctttga ccgtattgtg gaaaaaggct       480
     tctacacgga gcgggacgcc agccgcctca tcttccaggt gctggatgct gtgaaatacc       540
     tgcatgacct gggcattgta caccgggatc tcaagccaga gaatctgctg tactacagcc       600
     tggatgaaga ctccaaaatc atgatctccg actttggcct ctccaagatg gaggacccgg       660
     gcagtgtgct ctccaccgcc tgtggaactc cgggatacgt ggcccctgaa gtcctggccc       720
     agaagcccta cagcaaggct gtggattgct ggtccatagg tgtcatcgcc tacatcttgc       780
     tctgcggtta ccctcccttc tatgacgaga atgatgccaa actctttgaa cagattttga       840
     aggccgagta cgagtttgac tctccttact gggacgacat ctctgactct gccaaagatt       900
     tcatccggca cttgatggag aaggacccag agaaaagatt cacctgtgag caggccttgc       960
     agcacccatg gattgcagga gatacagctc tagataagaa tatccaccag tcggtgagtg      1020
     agcagatcaa gaagaacttt gccaagagca agtggaagca agccttcaat gccacggctg      1080
     tggtgcggca catgaggaaa ctgcagctgg gcaccagcca ggaggggcag gggcagacgg      1140
     cgagccatgg ggagctgctg acaccagtgg ctggggggcc ggcagctggc tgttgctgtc      1200
     gagactgctg cgtggagccg ggcacagaac tgtcccccac actgccccac cagctctagg      1260
     gccctggacc tcgggtcatg atcctctgcg tgggagggct tgggggcagc ctgctcccct      1320
     tccctccctg aaccgggagt ttctctgccc tgtcccctcc tcacctgctt ccctaccact      1380
     cctca                                                                  1385
//

If you have problems or comments...

PBIL Back to PBIL home page