(data stored in ACNUC15260 zone)

EMBL: BC106778

ID   BC106778; SV 1; linear; mRNA; STD; MUS; 918 BP.
XX
AC   BC106778;
XX
DT   04-OCT-2005 (Rel. 85, Created)
DT   05-OCT-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Mus musculus olfactory receptor 99, mRNA (cDNA clone MGC:123490
DE   IMAGE:40040272), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-918
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-918
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8402fe155bd2f4b6930820ab270665c7.
DR   Ensembl-Gn; ENSMUSG00000061972; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023707; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023665; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023636; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023671; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023434; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024109; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022919; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023411; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023536; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023509; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023614; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023532; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024155; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022666; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022985; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000077585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216328; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0047685; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0047665; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0047626; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0047631; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0047364; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048114; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0047426; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0047298; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0047397; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0047365; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0047500; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0047373; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048210; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047008; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0046686; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 10 Row: b Column: 12.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..918
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:123490 IMAGE:40040272"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: AACTCTAT sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..918
FT                   /gene="Olfr99"
FT                   /note="synonym: MOR156-1"
FT   CDS_pept        1..918
FT                   /codon_start=1
FT                   /gene="Olfr99"
FT                   /product="olfactory receptor 99"
FT                   /db_xref="GOA:Q8VFE4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2177482"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFE4"
FT                   /protein_id="AAI06779.1"
FT                   /translation="MNCSQAPTLILLGLSSDAEKWQPLFSIFLVIYLLGLLGNLLLLLA
FT                   IGTDVHLHTPMYFFLSQLSFVDLCFITTTAPKMLEALWTGDGSISFSGCLTQLYFFAVF
FT                   ADMDNLLLAVMAIDRYAAICHPLRYSALMTPFRCGVLVSGSWGVTNCVSLTHTLLLSKL
FT                   YFHTNQEIPHFFCEFGPLLLLSCSDTHLNKILVIILVGILGISAVLCIVSSYGCIFYAV
FT                   AKVPSAQGKRKALSTCSSHLSVVLLFYSTVFATYLKPPSSSRSSEEVVAAVMYSLVTPT
FT                   LNPFIYSLRNKDVKSSLRRILNME"
FT   misc_feature    1..918
FT                   /gene="Olfr99"
FT                   /note="This cDNA sequence aligns to the mouse C57BL/6J
FT                   genome (build 36) without differences"
XX
SQ   Sequence 918 BP; 197 A; 221 C; 187 G; 313 T; 0 other;
     atgaactgca gtcaggctcc tacattaatc ctcttgggac tgtctagtga tgcagagaaa        60
     tggcagcccc tctttagcat cttccttgtt atctacttgc tgggtctctt agggaacctg       120
     ctacttttgt tagctattgg cactgatgtc cacctccaca cccccatgta tttcttcctc       180
     agtcagctct catttgtgga tctttgcttc atcaccacca cagcccctaa aatgctggag       240
     gctctgtgga ctggagatgg atcaatctca ttctctggat gcctaactca gttgtacttc       300
     tttgctgttt ttgctgacat ggataacctg cttctagcag tcatggctat tgacaggtat       360
     gccgctatct gtcatccact gcgctactca gctctcatga ctccttttag atgtggggtt       420
     ctagtcagtg ggtcatgggg agtaactaat tgtgtgtctc tgacccatac tttgttgctc       480
     tctaagttat atttccatac caatcaagag attcctcatt ttttctgtga atttgggcct       540
     ctcttattgc tttcctgctc agatactcac ctcaataaaa tcctggtgat aattttggtt       600
     ggaattttag gaatcagtgc ggttctctgc attgtaagtt cttatggttg tattttttat       660
     gctgtggcta aggttccatc agcacagggg aaaaggaaag cattgtccac gtgcagttcc       720
     cacctctctg tagtcctcct tttctacagc acagtctttg ctacctacct gaagccccca       780
     tctagttctc gttcctctga ggaggtggta gctgctgtca tgtattctct cgtaactccc       840
     actctgaatc ccttcattta tagtctgaga aataaggatg ttaaaagttc attgaggaga       900
     atcctaaaca tggagtag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page