(data stored in ACNUC7820 zone)

EMBL: BC106989

ID   BC106989; SV 1; linear; mRNA; STD; MUS; 956 BP.
XX
AC   BC106989;
XX
DT   04-OCT-2005 (Rel. 85, Created)
DT   05-OCT-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Mus musculus olfactory receptor 836, mRNA (cDNA clone MGC:129243
DE   IMAGE:40043350), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-956
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-956
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 769691c2e6a3b807421e833a33fae43b.
DR   Ensembl-Gn; ENSMUSG00000059303; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074986; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 11 Row: g Column: 18.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..956
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:129243 IMAGE:40043350"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: TTTTAA sequenced from the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..956
FT                   /gene="Olfr836"
FT                   /note="synonym: MOR152-3"
FT   CDS_pept        1..954
FT                   /codon_start=1
FT                   /gene="Olfr836"
FT                   /product="olfactory receptor 836"
FT                   /db_xref="GOA:Q8VFJ3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030670"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFJ3"
FT                   /protein_id="AAI06990.1"
FT                   /translation="MCKMEVENKSVVFDIFLHGLTDDTELQPFIFGLFLCMYLITIFGN
FT                   LLIILAIICDSHLHTPMYFFLCHLAFNDMYLISITVPKMLVNIQTQDQRITFAGCLSQG
FT                   CFVAVCTIFECFLLGIMAYDRFIAICYPLRYTVLMNPCFCVILTLISLFFSIVNGLLHS
FT                   LMVLHLSFCTDLEILHFFCEIAQILKLACSDSLINNILIFVTSSIFAGVPLCGIIFSYV
FT                   HIVSTVLKMPSLEGKYKAFSTCGSHLSVVSLFYGTGFGVYISSNVIDSPKKIAMASVMY
FT                   SIVPPMMNPFIYSMRNRNMKEALKKVIGRKLLFSDV"
FT   misc_difference 956
FT                   /gene="Olfr836"
FT                   /note="1 base at the 3' end does not align to the mouse
FT                   genome."
XX
SQ   Sequence 956 BP; 236 A; 195 C; 174 G; 351 T; 0 other;
     atgtgcaaaa tggaagttga aaacaaatca gttgtttttg atatttttct tcatggactt        60
     acagatgata cagagcttca gccctttatc tttggccttt ttctatgcat gtatttgatc       120
     accatctttg gaaatcttct tataatattg gccatcattt gtgactctca cctccacaca       180
     cccatgtact tctttctctg ccatctggct tttaatgaca tgtatttaat cagcattaca       240
     gtcccaaaga tgttggtgaa tatacaaaca caggatcaga ggatcacttt tgctggctgc       300
     ctgagccagg gatgctttgt tgctgtttgt accatctttg agtgttttct ccttggaata       360
     atggcctatg accgcttcat agccatttgt tatcctctaa gatacacagt cctcatgaat       420
     ccctgcttct gtgttattct gactcttatc tctctattct ttagtattgt aaatggtctg       480
     ctgcatagtc tgatggtgct gcacttgtcc ttctgcacag acctggaaat cctccacttc       540
     ttctgtgaaa ttgcacaaat cctcaagctt gcctgttctg acagcctaat caacaacatc       600
     ttgatatttg ttacatcttc tatttttgct ggtgttcctc tatgtggaat aatcttttct       660
     tatgttcaca ttgtttctac agtgttgaaa atgccatcat tagaaggaaa gtacaaagcc       720
     ttctccacgt gtgggtctca tttatcagtt gtttccttgt tctatgggac aggttttggt       780
     gtatacattt cctcaaatgt aattgattca ccaaagaaga ttgccatggc ttcagtgatg       840
     tattcaatag ttcctccaat gatgaatccc tttatctata gtatgaggaa caggaatatg       900
     aaagaggcat tgaagaaggt aattggtagg aagcttcttt tctctgatgt gtgatt           956
//

If you have problems or comments...

PBIL Back to PBIL home page