(data stored in ACNUC21562 zone)

EMBL: BC107390

ID   BC107390; SV 1; linear; mRNA; STD; MUS; 1731 BP.
XX
AC   BC107390;
XX
DT   04-OCT-2005 (Rel. 85, Created)
DT   04-NOV-2006 (Rel. 89, Last updated, Version 6)
XX
DE   Mus musculus MAS-related GPR, member B2, mRNA (cDNA clone MGC:130390
DE   IMAGE:40057815), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1731
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1731
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7dc0773cd36f6a86448761a59282e149.
DR   Ensembl-Gn; ENSMUSG00000050425; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032292; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032271; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032207; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032283; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031996; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032776; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031324; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031961; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032118; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032072; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032199; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032109; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032793; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031044; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031442; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000052730; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084043; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0084116; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0084066; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084091; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083661; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084587; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084173; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0083602; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083788; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083644; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083807; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083695; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084863; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083589; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082715; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 16 Row: o Column: 1.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1731
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:130390 IMAGE:40057815"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: TATTTAA sequenced from
FT                   the reverse primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..1731
FT                   /gene="Mrgprb2"
FT   CDS_pept        65..1081
FT                   /codon_start=1
FT                   /gene="Mrgprb2"
FT                   /product="MAS-related GPR, member B2"
FT                   /db_xref="GOA:Q3KNA1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:2441674"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KNA1"
FT                   /protein_id="AAI07391.1"
FT                   /translation="MSGDFLIKNLSTSAWKTNITVLNGSYYIDTSVCVTRNQAMILLSI
FT                   IISLVGMGLNAIVLWFLGIRMHTNAFTVYILNLAMADFLYLCSQFVICLLIAFYIFYSI
FT                   DINIPLVLYVVPIFAYLSGLSILSTISIERCLSVIWPIWYRCKRPRHTSAITCFVLWVM
FT                   SLLLGLLEGKACGLLFNSFDSYWCETFDVITNIWSVVFFGVLCGSSLTLLVRIFCGSQR
FT                   IPMTRLYVTITLTVLVFLIFGLPFGIYWILYQWISNFYYVEICNFYLEILFLSCVNSCM
FT                   NPIIYFLVGSIRHRRFRRKTLKLLLQRAMQDTPEEEQSGNKSSSEHPEELETVQSCS"
FT   misc_difference 1102^1103
FT                   /gene="Mrgprb2"
FT                   /note="1 base in the mouse genome, A, is not found in
FT                   cDNA."
FT   misc_difference 1731
FT                   /gene="Mrgprb2"
FT                   /note="1 base at the 3' end does not align to the mouse
FT                   genome."
XX
SQ   Sequence 1731 BP; 465 A; 347 C; 320 G; 599 T; 0 other;
     aggactcttc tctttgtcac agaccagttt aacacttccc ataagaagaa tagagcaaag        60
     gaacatgagt ggagatttcc taatcaagaa tctaagcacc tcagcctgga aaacgaacat       120
     cacagtgctg aatggaagct actacatcga tacttcagtt tgtgtcacca ggaaccaagc       180
     catgattttg ctttccatca tcatttccct ggttgggatg ggactaaatg ccatagtgct       240
     gtggttcctg ggcatccgta tgcacacgaa tgccttcact gtctacattc tcaacctggc       300
     tatggctgac tttctttacc tgtgctctca gtttgtaatt tgtcttctta ttgcctttta       360
     tatcttctac tcaattgaca tcaacatccc tttggttctt tatgttgtgc caatatttgc       420
     ttatctttca ggtctgagca ttctcagcac cattagcatt gagcgctgct tgtctgtaat       480
     atggcccatt tggtatcgct gtaaacgtcc aagacacaca tcagctatca catgttttgt       540
     gctttgggtt atgtccttat tgttgggtct cctggaaggg aaggcatgtg gcttactgtt       600
     taatagcttt gactcttatt ggtgtgaaac atttgatgtt atcactaata tatggtcagt       660
     tgtttttttt ggtgttctct gtgggtctag cctcaccctg cttgtcagga tcttctgtgg       720
     ctcacagcga attcctatga ccaggctgta tgtgactatt acactcacag tcttggtctt       780
     cctgatcttt ggtcttccct ttgggatcta ttggatactc tatcagtgga ttagcaattt       840
     ttattatgtt gaaatttgta atttttatct tgagatacta ttcctatcct gtgttaacag       900
     ctgtatgaac cccatcattt atttccttgt tggctccatt aggcaccgaa ggttcaggcg       960
     gaagactctc aagctacttc tgcagagagc catgcaagac acccctgagg aggaacaaag      1020
     tggaaataag agttcttcag aacaccctga agaactggaa actgttcaga gctgcagctg      1080
     acaactgctt gatcagacaa aatggttttg atggaaatac tttttcttat ccgtgtggac      1140
     catttttaca acctttattc agtttgttat ctcatcttca attgtttaat taggacaata      1200
     atttttgtaa aagttgagag aaatgggtct tgtcatacta atactgaatg tagcatttct      1260
     gaagctgtgt tacttaggga tttaccatct ccttttcatg ggactccttg taagtattct      1320
     gtggtagaga acttctccta ttgttgacaa actctccttt agaaggcaaa tggaaataca      1380
     aggaagggct gtatttcttt acccactgaa atgtataatg agtacacaaa tgttacatct      1440
     agcaaatatt cttttagaac acccttctca atgtttaaga cttaaataga aacactttat      1500
     aatcctagtc cttattaatt tcttcaggtt ataaagaata tatgaagtga tagttttttt      1560
     acgtaaattt tttactaaac aaataaaatt tctcaaaaga agactgttaa atctctctta      1620
     acccagctga gtcctcactg tgaacatcaa gttcactgtg tctctaattt ttaaaatttg      1680
     aagagtgcac ttagatttgg caatgagatc catcaaaatc catgtccaca a               1731
//

If you have problems or comments...

PBIL Back to PBIL home page