(data stored in ACNUC21562 zone)

EMBL: BC107391

ID   BC107391; SV 2; linear; mRNA; STD; MUS; 1731 BP.
XX
AC   BC107391;
XX
DT   04-OCT-2005 (Rel. 85, Created)
DT   04-NOV-2006 (Rel. 89, Last updated, Version 6)
XX
DE   Mus musculus MAS-related GPR, member B2, mRNA (cDNA clone MGC:130391
DE   IMAGE:40057816), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1731
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1731
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 9010132e95415835d4a764c7e4e15912.
DR   Ensembl-Gn; ENSMUSG00000050425; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032292; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032271; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032207; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032283; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031996; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032776; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031324; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031961; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032118; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032072; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032199; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032109; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032793; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031044; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031442; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000052730; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084043; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0084116; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0084066; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084091; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083661; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084587; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084173; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0083602; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083788; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083644; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083807; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083695; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084863; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083589; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082715; mus_musculus_wsbeij.
XX
CC   On Nov 1, 2006 this sequence version replaced gi:76825587.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 16 Row: o Column: 2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1731
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:130391 IMAGE:40057816"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: TACTT sequenced from the
FT                   forward primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..1731
FT                   /gene="Mrgprb2"
FT   CDS_pept        65..1081
FT                   /codon_start=1
FT                   /gene="Mrgprb2"
FT                   /product="MAS-related GPR, member B2"
FT                   /db_xref="GOA:Q3KNA1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:2441674"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KNA1"
FT                   /protein_id="AAI07392.1"
FT                   /translation="MSGDFLIKNLSTSAWKTNITVLNGSYYIDTSVCVTRNQAMILLSI
FT                   IISLVGMGLNAIVLWFLGIRMHTNAFTVYILNLAMADFLYLCSQFVICLLIAFYIFYSI
FT                   DINIPLVLYVVPIFAYLSGLSILSTISIERCLSVIWPIWYRCKRPRHTSAITCFVLWVM
FT                   SLLLGLLEGKACGLLFNSFDSYWCETFDVITNIWSVVFFGVLCGSSLTLLVRIFCGSQR
FT                   IPMTRLYVTITLTVLVFLIFGLPFGIYWILYQWISNFYYVKICNFYLEILFLSCVNSCM
FT                   NPIIYFLVGSIRHRRFRRKTLKLLLQRAMQDTPEEEQSGNKSSSEHPEELETVQSCS"
XX
SQ   Sequence 1731 BP; 466 A; 347 C; 319 G; 599 T; 0 other;
     aggactcttc tctttgtcac agaccagttt aacacttccc ataagaagaa tagagcaaag        60
     gaacatgagt ggagatttcc taatcaagaa tctaagcacc tcagcctgga aaacgaacat       120
     cacagtgctg aatggaagct actacatcga tacttcagtt tgtgtcacca ggaaccaagc       180
     catgattttg ctttccatca tcatttccct ggttgggatg ggactaaatg ccatagtgct       240
     gtggttcctg ggcatccgta tgcacacgaa tgccttcact gtctacattc tcaacctggc       300
     tatggctgac tttctttacc tgtgctctca gtttgtaatt tgtcttctta ttgcctttta       360
     tatcttctac tcaattgaca tcaacatccc tttggttctt tatgttgtgc caatatttgc       420
     ttatctttca ggtctgagca ttctcagcac cattagcatt gagcgctgct tgtctgtaat       480
     atggcccatt tggtatcgct gtaaacgtcc aagacacaca tcagctatca catgttttgt       540
     gctttgggtt atgtccttat tgttgggtct cctggaaggg aaggcatgtg gcttactgtt       600
     taatagcttt gactcttatt ggtgtgaaac atttgatgtt atcactaata tatggtcagt       660
     tgtttttttt ggtgttctct gtgggtctag cctcaccctg cttgtcagga tcttctgtgg       720
     ctcacagcga attcctatga ccaggctgta tgtgactatt acactcacag tcttggtctt       780
     cctgatcttt ggtcttccct ttgggatcta ttggatactc tatcagtgga ttagcaattt       840
     ttattatgtt aaaatttgta atttttatct tgagatacta ttcctatcct gtgttaacag       900
     ctgtatgaac cccatcattt atttccttgt tggctccatt aggcaccgaa ggttcaggcg       960
     gaagactctc aagctacttc tgcagagagc catgcaagac acccctgagg aggaacaaag      1020
     tggaaataag agttcttcag aacaccctga agaactggaa actgttcaga gctgcagctg      1080
     acaactgctt gatcagacaa aaatggtttt gatggaaata ctttttctta tccgtgtgga      1140
     ccatttttac aacctttatt cagtttgtta tctcatcttc aattgtttaa ttaggacaat      1200
     aatttttgta aaagttgaga gaaatgggtc ttgtcatact aatactgaat gtagcatttc      1260
     tgaagctgtg ttacttaggg atttaccatc tccttttcat gggactcctt gtaagtattc      1320
     tgtggtagag aacttctcct attgttgaca aactctcctt tagaaggcaa atggaaatac      1380
     aaggaagggc tgtatttctt tacccactga aatgtataat gagtacacaa atgttacatc      1440
     tagcaaatat tcttttagaa cacccttctc aatgtttaag acttaaatag aaacacttta      1500
     taatcctagt ccttattaat ttcttcaggt tataaagaat atatgaagtg atagtttttt      1560
     tacgtaaatt ttttactaaa caaataaaat ttctcaaaag aagactgtta aatctctctt      1620
     aacccagctg agtcctcact gtgaacatca agttcactgt gtctctaatt tttaaaattt      1680
     gaagagtgca cttagatttg gcaatgagat ccatcaaaat ccatgtccac a               1731
//

If you have problems or comments...

PBIL Back to PBIL home page