(data stored in ACNUC30567 zone)

EMBL: BC107437

ID   BC107437; SV 1; linear; mRNA; STD; ROD; 2472 BP.
XX
AC   BC107437;
XX
DT   28-OCT-2005 (Rel. 85, Created)
DT   18-JUL-2006 (Rel. 88, Last updated, Version 4)
XX
DE   Rattus norvegicus a disintegrin and metalloprotease domain 4, mRNA (cDNA
DE   clone MGC:125044 IMAGE:7132937), complete cds.
XX
KW   MGC.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-2472
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2472
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-OCT-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 01843f16b45d1b36de8e6277cba18475.
DR   Ensembl-Gn; ENSRNOG00000038275; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000008367; rattus_norvegicus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Howard Jacobs
CC   cDNA Library Preparation: Express Genomics
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 244 Row: b Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 83523737.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2472
FT                   /organism="Rattus norvegicus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_238"
FT                   /clone="MGC:125044 IMAGE:7132937"
FT                   /tissue_type="Testis, rat (Brown Norway)"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:10116"
FT   gene            1..2472
FT                   /gene="Adam4"
FT                   /note="synonym: tMDCV"
FT   CDS_pept        47..2314
FT                   /codon_start=1
FT                   /gene="Adam4"
FT                   /product="a disintegrin and metalloprotease domain 4"
FT                   /db_xref="GOA:Q3B7V9"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR033959"
FT                   /db_xref="InterPro:IPR034027"
FT                   /db_xref="InterPro:IPR036436"
FT                   /db_xref="UniProtKB/TrEMBL:Q3B7V9"
FT                   /protein_id="AAI07438.1"
FT                   /translation="MAPFLRPSTWTWVLLEGALWLSVLCSLLSSVCCSHGPPKWRFSTS
FT                   EVVIPRKVPQRMGKSDMSGQITYSMRFRGQRHVVHMKLKKNMISQNFPVYTSNDQGAQQ
FT                   EDYPFVPQDCYFYSYLEGVPGSQATLDTCTGGLKGMIRVDDSTYEIKPLTSSSKFEHVI
FT                   SLLVVDERSRKSKKCRNDEIMAEAGDPLEETKLAGSPRAAPVYLWRIHVKNIAIMYTVT
FT                   HALFIQVGHNQTTSLELVLIMNSIADSIYRPSGLIVFARAICIWNKQDNFNITEYSDSV
FT                   IKLMEQFGYWKSTFYWDFPHATSALLSGTKYGNKDYAAFQNGLCNPNWGVLYTHVGKNH
FT                   FFLAASLMSHAVGHIFNIGHDKPGCVCFRRSSCVMSEFPTLLDMMSNCSHHNLHEKIIG
FT                   WDACLSQPRVAYKNFKYAVPRCGNKVVDDNEQCDCGTLKDCLSNHCCGTNCQLIGSSTC
FT                   AEGLCCQSCRFAPTGKVCRHTNGICDLPEYCSGVSEHCPQNFYIMDGTPCSPLAVCMSG
FT                   NCSDRQLQCQALFGYHVKDASPACYKELNTKGDRFGNCGVREVRGGSKPLACQEEDIFC
FT                   GQIHCDGVKFVPGGGEHTTFHHIKVMDVKEEQCFGYDAHHGTELPEMGLVLDGANCGPG
FT                   KFCKAQKCVIHTELNFHCNITQCNYKGVCNNKGNCHCVPGFQPPHCIQRGTGGSVNSGP
FT                   PATFQEKLRAEIHVSINRLIIIIGTRILLILASVLFGALFRALMLETEKKKKKTQHPTI
FT                   NK"
XX
SQ   Sequence 2472 BP; 741 A; 497 C; 542 G; 692 T; 0 other;
     gttttagtct tgtctgccac ccagtggacc agatttggtt tggttcatgg ctcccttcct        60
     cagaccatct acctggactt gggtcctcct ggaaggtgct ctctggctct ctgtgctctg       120
     ttcactgttg tcttctgtct gctgttccca tggtccaccc aaatggcgct tctctacctc       180
     tgaagttgtg atccccagga aggttcccca gagaatgggt aaaagtgata tgtcagggca       240
     aatcacctat agcatgcgct ttaggggaca aagacatgtg gtccacatga aactcaagaa       300
     gaacatgatt tctcaaaact ttcctgtata tacttctaat gaccaaggag cccagcaaga       360
     ggattacccc tttgtccctc aggactgtta cttctacagc tacctggaag gagtccctgg       420
     gtcccaagct acactagata cctgcactgg aggtctgaaa ggcatgatac gggtggatga       480
     ctccacttat gaaatcaaac cattgacatc ttcttccaaa tttgagcatg taatttctct       540
     acttgtggtg gatgaaaggt cacgtaagtc taaaaagtgt agaaatgatg agattatggc       600
     agaggcaggt gacccccttg aagagactaa gcttgcagga agtcccagag cagctcccgt       660
     atatctgtgg cgtatacatg tgaaaaatat agcaataatg tacactgtga ctcacgcatt       720
     attcatacaa gtagggcaca accaaaccac ctcacttgag ttagtattga ttatgaacag       780
     catagcagat agcatatata gaccaagtgg tttgattgtg tttgcacgtg ctatatgtat       840
     ttggaacaaa caggacaact tcaatataac agaatatagt gacagtgtta taaaacttat       900
     ggaacagttt gggtattgga aatctacatt ttattgggat tttccacacg ccacttcagc       960
     tcttctctca ggaacgaaat atggaaacaa agattatgca gcctttcaga atggattatg      1020
     taaccccaac tggggagttt tatatacaca tgtaggaaaa aaccattttt ttctggctgc      1080
     atctttaatg tctcatgcag tgggtcacat tttcaatata ggacatgata aacctggctg      1140
     tgtttgtttc agaaggagca gttgtgtcat gagtgaattt cctactcttc tggacatgat      1200
     gagcaattgt tcccatcata atctacatga gaagatcatt ggttgggacg cttgcttgag      1260
     tcaaccgcgg gttgcatata agaatttcaa atatgcagtt cctcgttgtg gaaataaggt      1320
     agtggatgac aatgagcaat gtgactgtgg tactttaaaa gactgtctct ctaatcactg      1380
     ttgtggaacc aattgtcagt taattgggag cagcacttgt gctgaaggac tttgttgtca      1440
     atcttgtagg tttgcaccca ctggaaaggt atgcaggcac acgaatggca tttgtgatct      1500
     tccagaatac tgtagtggag tctcagagca ttgcccacaa aatttctaca tcatggatgg      1560
     aaccccttgt tctccactag cagtctgcat gtcaggaaac tgtagcgacc gccaattgca      1620
     gtgtcaagct ctttttggat accatgtaaa ggatgcttca ccagcatgct ataaagaatt      1680
     aaataccaaa ggtgaccgat ttggaaactg tggggttaga gaggtacgtg gaggaagtaa      1740
     acctctcgca tgtcaagagg aggatatttt ctgtggacag attcactgtg acggtgtcaa      1800
     gttcgttcct ggtggaggtg agcacactac ctttcatcac ataaaggtaa tggatgttaa      1860
     agaagaacag tgctttgggt atgatgcaca ccatgggaca gaacttccgg aaatgggact      1920
     tgtattggat ggtgcaaatt gtggccctgg caaattctgt aaagctcaaa aatgtgttat      1980
     tcacacagag ttgaattttc actgcaacat tactcagtgt aactataaag gggtgtgtaa      2040
     caacaaaggc aactgtcact gtgttccagg atttcaacca ccacattgta tacaaagagg      2100
     aacaggtggt agtgtaaaca gtggccctcc ggctaccttt caggaaaaac ttcgagctga      2160
     aatacatgtg agtatcaaca ggctaataat tattataggt actcgcatcc ttcttatctt      2220
     ggcttcagtt ctttttggtg cgcttttcag agcactaatg ctagagactg aaaaaaagaa      2280
     aaaaaagacc caacatccaa ctattaacaa ataattgact tcatcccaaa ctaattggag      2340
     ccacacaatg gacaaaatcc atgtccatcg atgatgtctc ctgacattcg tgcaaccatt      2400
     cacaaatctg agaatttcat cttgaaataa aatcactggg gaactagaaa aaaaaaaaaa      2460
     aaaaaaaaaa aa                                                          2472
//

If you have problems or comments...

PBIL Back to PBIL home page