(data stored in ACNUC8465 zone)

EMBL: BC107821

ID   BC107821; SV 1; linear; mRNA; STD; VRT; 1435 BP.
XX
AC   BC107821;
XX
DT   01-NOV-2005 (Rel. 85, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Danio rerio mitogen-activated protein kinase kinase 2, mRNA (cDNA clone
DE   MGC:123171 IMAGE:7222163), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1435
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1435
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (23-OCT-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 5769ad5c4515fa42d1cf32ea8e621f8c.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Will Talbot
CC   cDNA Library Preparation: Dr. Yutaka Suzuki and Dr. Sumio Sugano
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 239 Row: b Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 78394985.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1435
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_15"
FT                   /clone="MGC:123171 IMAGE:7222163"
FT                   /tissue_type="Embryo, whole, 2-8 hr, mixed wild type, pool
FT                   of 2500 embryos"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..1435
FT                   /gene="map2k2"
FT                   /note="synonyms: zgc:123171, wu:fa56c06"
FT   CDS_pept        522..1379
FT                   /codon_start=1
FT                   /gene="map2k2"
FT                   /product="mitogen-activated protein kinase kinase 2"
FT                   /db_xref="GOA:Q32Q50"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q32Q50"
FT                   /db_xref="ZFIN:ZDB-GENE-041027-1"
FT                   /protein_id="AAI07822.1"
FT                   /translation="MAPKRRPVPLIITPTGEGQSTNIDAAAEANLEALQRKLGELDLDE
FT                   QQRKRLEAFLTQKAQVGELKDEDFEPICELGAGNGGVVHKVRHKPSRLVMARKLIHLEI
FT                   KPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIP
FT                   EEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAN
FT                   SFVGTRSYMSPERLQGTHYSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEAIFGRKFF
FT                   KFKF"
XX
SQ   Sequence 1435 BP; 388 A; 327 C; 359 G; 361 T; 0 other;
     tggcctactg ggatgacgca agttctctgg cggcagttct cgcgagatcg agcaaacgct        60
     tcctcttggt tggttagcgg cttcctggcc ggactttttc cccctccttt tttcttgggg       120
     gaaatttcaa cttctgtttt cgcggctcct ccgagccaaa ctatttcgga cagcgtttct       180
     cgcccggtcc tgaggctgtg aacgataggc ctaacttgtc ttttgccgcc ttttgtctgt       240
     gggagcgctc gcgagtcaga ggccgtgccg gagagacatt ccagcgatgc acgcgcttaa       300
     ataaactgca tttcctgcac ttttacctct gagccactcg ctttttcatt tgacacttta       360
     atttcacctg gagcagcttt tgagagcatg attgggtgtt gaaatttggg gcttgctaat       420
     ctcagaaact tccactacaa gggtttgtgt atcagtttga agtattggat gtcagtagag       480
     acaacctggt tgctttcttt gaaattgata actttgcaag tatggcacca aaaagaagac       540
     cagtcccctt gattataacc cccactggag agggacagtc aaccaacatt gatgcagcag       600
     cagaggccaa cctggaggcc ttgcagagga agttaggtga gctggatttg gatgaacagc       660
     agaggaagcg cctcgaagct ttcctcaccc agaaagccca ggtgggcgag ctcaaggatg       720
     aagatttcga acccatatgt gaacttggcg ctggtaatgg tggagtggtt cataaagtcc       780
     gtcacaaacc ctcgagactg gttatggcca ggaagcttat acacttggaa atcaaaccag       840
     ccatcaggaa ccagattatt cgagagctgc aggttctaca cgagtgtaac tcaccgtaca       900
     ttgtagggtt ttacggcgcc ttctacagtg atggagaaat cagcatctgt atggagcaca       960
     tggatggagg ctctttggat caagtgctca aagaagccag aagaatccct gaggaaattt      1020
     tgggcaaagt tagcatagct gtactcagag gtttggcgta tcttcgggag aagcaccaaa      1080
     taatgcacag agacgttaag ccctccaaca tcctggtgaa ctcgcgcggt gagatcaaac      1140
     tgtgcgactt tggtgtgagt ggccagctca tcgactctat ggccaactcc ttcgttggaa      1200
     cacggtcgta catgtcgccg gagagactcc agggcacgca ctactcggtt cagtcggatg      1260
     tgtggagcat gggcctatca ctggttgagc ttgctattgg acgctacccc atcccccctc      1320
     ccgatgctaa ggaactggaa gccatatttg gccggaaatt ttttaaattt aaattttaag      1380
     taaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa           1435
//

If you have problems or comments...

PBIL Back to PBIL home page