(data stored in ACNUC23390 zone)

EMBL: BC108589

ID   BC108589; SV 1; linear; mRNA; STD; VRT; 1968 BP.
XX
AC   BC108589;
XX
DT   05-NOV-2005 (Rel. 85, Created)
DT   03-DEC-2006 (Rel. 90, Last updated, Version 2)
XX
DE   Xenopus laevis homeo box HB9, mRNA (cDNA clone MGC:131096 IMAGE:7982261),
DE   complete cds.
XX
KW   MGC.
XX
OS   Xenopus laevis (African clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus.
XX
RN   [1]
RP   1-1968
RX   DOI; 10.1002/dvdy.10174.
RX   PUBMED; 12454917.
RA   Klein S.L., Strausberg R.L., Wagner L., Pontius J., Clifton S.W.,
RA   Richardson P.;
RT   "Genetic and genomic tools for Xenopus research: The NIH Xenopus
RT   initiative";
RL   Dev. Dyn. 225(4):384-391(2002).
XX
RN   [2]
RP   1-1968
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [3]
RC   NIH-MGC Project
RP   1-1968
RA   Klein S., Gerhard D.S.;
RT   ;
RL   Submitted (03-NOV-2005) to the INSDC.
RL   National Institutes of Health, Xenopus Gene Collection (XGC), National
RL   Institute of Child Health and Human Development, 6100 Executive Boulevard,
RL   Room 4B01, Rockville, MD 20892-7510, USA
XX
DR   MD5; 105326c73ee756740e843c3ba555bd72.
XX
CC   Contact: XGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Igor Dawid
CC   cDNA Library Preparation: Express Genomics
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 254 Row: o Column: 4
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 80476476.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1968
FT                   /organism="Xenopus laevis"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NICHD_XGC_Emb10"
FT                   /clone="MGC:131096 IMAGE:7982261"
FT                   /tissue_type="Embryo, neurula stage"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:8355"
FT   gene            1..1968
FT                   /gene="hlxb9"
FT                   /note="synonym: MGC131096"
FT   CDS_pept        289..1290
FT                   /codon_start=1
FT                   /gene="hlxb9"
FT                   /product="hlxb9 protein"
FT                   /db_xref="GOA:Q32NJ8"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:Q32NJ8"
FT                   /protein_id="AAI08590.1"
FT                   /translation="MEKSKNFRIDALLAIDPPKAQTSPLALVTSLSSSSLSGSPPSEHT
FT                   DSLRTDSPSPPRTCGLVPKPGFLSSHQHPPNMMSLHPQAAPGIPPQALYGHPMYSYLAA
FT                   GQHPALSYPYSQMQSSHHPHPMDPIKISAGTFQLDQWLRASTAGMMLPKMADFNSQAQS
FT                   NLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRM
FT                   KWKRSKKAKEQAAQDSAEKQQRAGKGSSEEKCSDELQEEKKSYHLHPRGEPIKGNGRLQ
FT                   PRDYTDSEEDEEEDREEEEEEDHRGEGKRFYHHSSDCTSEEEENSHNKQSGH"
XX
SQ   Sequence 1968 BP; 517 A; 563 C; 504 G; 384 T; 0 other;
     ccgacctcct catactcagg ggccacagca gcaaacgccg cgccccacaa ggaaagtgac        60
     agtcagtccg gcagagctga agcctgaggc acagagagcg gagcaggagg aaggtccctc       120
     cgttatactc aggggtcgcg gactcttcta tccgcagatc acagacagac tggtagagac       180
     agtgtcagtg agttgagccc atcggattcc ctcctgcaca cagcgcagtg tcactgtttg       240
     ccactatcac tccgcaggga acacacggct ggagggcccg cacagctcat ggagaagtcc       300
     aagaatttca ggattgacgc tctcctggcg atagatcccc ccaaggctca gacctcccca       360
     ttggctctgg tcacctcgct gtcctcctcg tctctctccg ggagcccccc gtccgagcac       420
     actgacagcc tcaggactga ctccccctcc cctccaagga cttgtggact ggtccctaaa       480
     ccaggtttcc tgagcagcca ccagcacccc ccaaacatga tgtcattgca cccccaggct       540
     gctccaggga tcccccctca ggccctgtat ggacacccga tgtacagcta cttggcagcg       600
     gggcagcacc cagctctgtc ctacccctac tcccagatgc agagcagcca ccacccccac       660
     cccatggacc ccatcaagat cagcgctggc accttccaac tggaccagtg gctcagagcc       720
     tccactgccg gcatgatgct gcccaaaatg gcagacttta actcccaggc ccaatccaac       780
     ctgctgggaa agtgcagaag accaaggaca gcgtttacca gtcagcagct gttggaactg       840
     gagcaccaat tcaagctgaa caagtacctc tccaggccga aacgctttga agtggccact       900
     tccctgatgc tcactgagac gcaggtgaag atctggttcc agaacaggcg catgaaatgg       960
     aagaggagta agaaagccaa ggagcaggcg gcgcaggact cagcagagaa acagcagagg      1020
     gcaggcaagg gcagcagcga ggagaagtgc tcggatgagc tgcaggaaga gaagaaatcc      1080
     taccatctcc atcccagggg ggagcccatc aaagggaacg gccgcctgca gcccagagac      1140
     tatacagaca gcgaagagga cgaggaggag gacagggaag aggaggaaga ggaagatcac      1200
     agaggggagg ggaagcggtt ttaccatcat tcttctgact gcacatccga ggaagaggag      1260
     aacagccaca ataagcagag cggccactga gccagtatca ccctggcaca tcattgtcct      1320
     cccttcccta aagagacttg tattagagga gccatgtgat cattgttttg tgctagtacc      1380
     caggcccgga ctggcaatct gtgggttctg gcaaatgcca gaggggctgc tataaggtgc      1440
     catagaaagt cagtatttag tgggctggtg ggggctcttt gggcctctgt gtgcttgaaa      1500
     tgccagggcc tattttaatt ctcagtccgg acctgctagt accacccgcc gaccccttag      1560
     cggaaccccg ggcactcaga ctggatgagc ccagtccatt ccagcaccat ggagaggtcc      1620
     ttgccccaag cactgcccca tcatcactgg gtattgactg tattatccac tatactgact      1680
     gactcttccc tgctgggggg catttgttcc caggcagggt catgggggtt acacaggcta      1740
     ctgggagtcc cctacttttg tgttgacacc atcataagaa aacccgctgg gcacctgaag      1800
     gctacactat aggctgtctt tatttttgta cattgtattt ataaagaaaa aaaaatacct      1860
     ctacatatgc atgctaaatt attatttagc ctcctccatc ataacgatgg tatgtaaaat      1920
     aaattttgtt ttttacttgt aaaaaaaaaa aaaaaaaaaa aaaaaaaa                   1968
//

If you have problems or comments...

PBIL Back to PBIL home page