(data stored in ACNUC7421 zone)

EMBL: BC109686

ID   BC109686; SV 1; linear; mRNA; STD; MAM; 1567 BP.
XX
AC   BC109686;
XX
DT   15-DEC-2005 (Rel. 86, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Bos taurus enoyl Coenzyme A hydratase domain containing 2, mRNA (cDNA clone
DE   MGC:134069 IMAGE:8058584), complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-1567
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (09-NOV-2005) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; e541d71cdce95196584bd8b64b56b9ee.
DR   Ensembl-Gn; ENSBTAG00000002910; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000003779; bos_taurus.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: Y. Meng, M. Taniguchi, L. Guan and S. Moore
CC   cDNA Library Preparation: M. Masaaki, Y. Meng, S. Lobo,  L. Guan
CC   and Dr. S. Moore
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Tanaguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Chun E, Liao N, Beland J, Cruz K, Featherstone R, Kirk H,
CC   Matsuo C, Mayo M, Moore R, Munro S, Roger J, Tam B, Trinh E, Sze W,
CC   Wilton J, Wanger S, Huang P, Chu B, Imanian B, Roscoe R, Holt R,
CC   Jones S, Marra M
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 259 Row: a Column: 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1567
FT                   /organism="Bos taurus"
FT                   /lab_host="ElectroMAX DH10B"
FT                   /strain="Crossbred x Angus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-04"
FT                   /clone="MGC:134069 IMAGE:8058584"
FT                   /tissue_type="Liver, 6 month old female calf, Crossbred x
FT                   Angus"
FT                   /note="Vector: pCMV-SPORT6.0"
FT                   /db_xref="taxon:9913"
FT   gene            1..1567
FT                   /gene="ECHDC2"
FT   CDS_pept        22..912
FT                   /codon_start=1
FT                   /gene="ECHDC2"
FT                   /product="enoyl Coenzyme A hydratase domain containing 2"
FT                   /db_xref="GOA:Q2TBT3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2TBT3"
FT                   /protein_id="AAI09687.1"
FT                   /translation="MLRVLTSTLRFPRPWKPLETRGCSSNPGAAGREIQVCALAGPNQG
FT                   IAEILMNRPSARNALGNVFVSQLLEALAQLREDRQVRVLIFRSGVKGVFCAGADLKERE
FT                   QMSEAEVGLFVQRLRGLMTEIAAFPAPTIAAMDGFALGGGLELALACDLRVAASSAVMG
FT                   LIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLSGAQAQALGLVNHAVAQNEEGN
FT                   AAYHRARALAQEILPQAPIAVRLSKVAIDRGIEVDIASGMAIEGICYAQNIPTRDRLEG
FT                   MAAFREKRLPRFVGE"
XX
SQ   Sequence 1567 BP; 406 A; 421 C; 426 G; 314 T; 0 other;
     gcgttcccaa agtgggcccc catgctgcgc gtcctgacca gcaccctgcg ctttccgcgc        60
     ccctggaagc cgcttgagac ccgcggctgc tcctccaacc ccggggctgc cggccgggag       120
     atccaggtgt gcgctctggc gggtccaaac cagggaattg ctgagattct gatgaacaga       180
     cccagtgccc gcaatgccct ggggaacgtc ttcgtcagtc agctgctgga agctcttgcc       240
     cagcttcggg aggaccgtca agtgcgtgtc ctgatcttca ggagtggagt gaagggtgtg       300
     ttctgcgcag gtgcagacct gaaggagcgg gagcagatga gtgaggcaga agtggggctc       360
     tttgtccagc ggcttcgagg cctgatgact gagattgcag cgttccctgc acccaccatt       420
     gcagctatgg atgggtttgc cttgggtgga ggcctggaac ttgccctggc ctgtgacctc       480
     cgagtggcag cttcctcggc tgtcatggga ctgatcgaga ccacccgagg gctcctccca       540
     ggagcaggag ggactcagag gctgcctcga tgcctggggg tggccctggc gaaggagctc       600
     atcttcacag gccgacgact gagtggggcg caggcccagg ctctggggct ggtgaaccac       660
     gctgtggccc agaacgagga gggcaatgct gcctaccacc gggcacgagc actggcccag       720
     gagatcctac cccaggcccc cattgctgtg cggctgagca aagtagccat tgaccgagga       780
     atagaggtgg acatcgcatc agggatggcc attgaaggga tatgctacgc ccagaacatc       840
     ccaacccggg atcggctgga aggcatggct gctttcaggg agaagcgcct ccccagattt       900
     gttggcgagt gacctccatt taacctgaag caagggagat gcacagctta cagggcagga       960
     tccagaagga agatgtgcag cacctctgcc ctcatcattt cacctctgcc cttatcattt      1020
     cacctctctg ggttccagat tcctcacaag gacaatgatg gataggaaat aacaggcatg      1080
     gtgcctggta ctagggtgct gactatgcca cctactactc ccttcattac tcctcaccca      1140
     ggcgagctca tcactggggt gaggttggct ttggagcata cctgtctctc cctaatagaa      1200
     caataaacta aggataaaac agacccctct gggcccttat agcactggca cccaagtctg      1260
     atcactgcgt ctcagttatt aggtgctcac cagagatgca agatgctgta agaaccaccc      1320
     cacaatggcc ctgtttctcc ctcagtacaa tagagataat aaggagacct tggttgtggt      1380
     tgaatagact cagctctctg ccagttactc actgtttgcc tcagcctcct caactataat      1440
     gaacctgtct tgaggattaa aaaataataa aatacctgat gttccagaaa aaaaaaaaaa      1500
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1560
     aaaaaaa                                                                1567
//

If you have problems or comments...

PBIL Back to PBIL home page