(data stored in ACNUC31108 zone)

EMBL: BC110379

ID   BC110379; SV 1; linear; mRNA; STD; HUM; 1269 BP.
XX
AC   BC110379;
XX
DT   09-AUG-2006 (Rel. 88, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens CD37 molecule, mRNA (cDNA clone MGC:117412 IMAGE:5752290),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1269
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1269
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (25-NOV-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; f6ec02c669cea3fe6355ca86424a3538.
DR   Ensembl-Gn; ENSG00000104894; homo_sapiens.
DR   Ensembl-Tr; ENST00000323906; homo_sapiens.
DR   Ensembl-Tr; ENST00000426897; homo_sapiens.
DR   Ensembl-Tr; ENST00000598095; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Life Technologies, Inc.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 233 Row: o Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 4502662.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1269
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_115"
FT                   /clone="MGC:117412 IMAGE:5752290"
FT                   /tissue_type="Brain, Lung, Testis, adult, pooled whole"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..1269
FT                   /gene="CD37"
FT                   /note="synonyms: TSPAN26, GP52-40"
FT   CDS_pept        74..919
FT                   /codon_start=1
FT                   /gene="CD37"
FT                   /product="CD37 molecule"
FT                   /db_xref="GOA:P11049"
FT                   /db_xref="H-InvDB:HIT000386525.7"
FT                   /db_xref="HGNC:HGNC:1666"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P11049"
FT                   /protein_id="AAI10380.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVS
FT                   FVGLAFVPLQIWSKVLAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQ
FT                   VLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAE
FT                   SHIYREGCAQGLQKWLHNNLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR
FT                   "
XX
SQ   Sequence 1269 BP; 284 A; 412 C; 296 G; 277 T; 0 other;
     ctttctccct gtctccccca ctgtcagcac ctcttctgtg tggtgagtgg accgcttacc        60
     ccactaggtg aagatgtcag cccaggagag ctgcctcagc ctcatcaagt acttcctctt       120
     cgttttcaac ctcttcttct tcgtcctcgg cagcctgatc ttctgcttcg gcatctggat       180
     cctcatcgac aagaccagct tcgtgtcctt tgtgggcttg gccttcgtgc ctctgcagat       240
     ctggtccaaa gtcctggcca tctcaggaat cttcaccatg ggcatcgccc tcctgggttg       300
     tgtgggggcc ctcaaggagc tccgctgcct cctgggcctg tattttggga tgctgctgct       360
     cctgtttgcc acacagatca ccctgggaat cctcatctcc actcagcggg cccagctgga       420
     gcgaagcttg cgggacgtcg tagagaaaac catccaaaag tacggcacca accccgagga       480
     gaccgcggcc gaggagagct gggactatgt gcagttccag ctgcgctgct gcggctggca       540
     ctacccgcag gactggttcc aagtcctcat cctgagaggt aacgggtcgg aggcgcaccg       600
     cgtgccctgc tcctgctaca acttgtcggc gaccaacgac tccacaatcc tagataaggt       660
     gatcttgccc cagctcagca ggcttggaca cctggcgcgg tccagacaca gtgcagacat       720
     ctgcgctgtc cctgcagaga gccacatcta ccgcgagggc tgcgcgcagg gcctccagaa       780
     gtggctgcac aacaacctta tttccatagt gggcatttgc ctgggcgtcg gcctactcga       840
     gctcgggttc atgacgctct cgatattcct gtgcagaaac ctggaccacg tctacaaccg       900
     gctcgctcga taccgttagg ccccgccctc cccaaagtcc cgccccgccc ccgtcacgtg       960
     cgctgggcac ttccctgctg cctgtaaata tttgtttaat ccccagttcg cctggagccc      1020
     tccgccttca cattcccctg gggacccacg tggctgcgtg cccctgctgc tgtcacctct      1080
     cccacgggac ctggggcttt cgtccacagc ttcctgtccc catctgtcgg cctaccacca      1140
     cccacaagat tatttttcac ccaaacctca aataaatccc ctgcgttttt ggtaaaaaaa      1200
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1260
     aaaaaaaaa                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page