(data stored in ACNUC23583 zone)

EMBL: BC111278

ID   BC111278; SV 1; linear; mRNA; STD; MAM; 1590 BP.
XX
AC   BC111278;
XX
DT   10-DEC-2005 (Rel. 86, Created)
DT   24-JAN-2007 (Rel. 90, Last updated, Version 6)
XX
DE   Bos taurus leucine rich repeat containing 61, mRNA (cDNA clone MGC:134571
DE   IMAGE:8067689), complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-1590
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (07-DEC-2005) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; d2dcc50ef7b9c8b9ec3e8ed8a67f2a6a.
DR   Ensembl-Gn; ENSBTAG00000031059; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000043967; bos_taurus.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: Y. Meng, M. Taniguchi, L. Guan and S. Moore
CC   cDNA Library Preparation: M. Masaaki, Y. Meng, S. Lobo,  L. Guan
CC   and Dr. S. Moore
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Taniguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Bala M, Barber S, Babakaiff R, Beland J, Chand S, Chun E,
CC   Del Rio L, Gibson S, Kirkpatrick R, Liu J, Matsuo C, Mayo M,
CC   Palmquist D, Santos RR, Stott J, Tsai M, Wong D, Wynhoven B, Hanson
CC   R, Siddiqui A, Holt R, Jones SJ, Marra MA
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 259 Row: n Column: 7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1590
FT                   /organism="Bos taurus"
FT                   /lab_host="ElectroMAX DH10B"
FT                   /strain="Crossbred x Angus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-04"
FT                   /clone="MGC:134571 IMAGE:8067689"
FT                   /tissue_type="Liver, 6 month old female calf, Crossbred x
FT                   Angus"
FT                   /note="Vector: pCMV-SPORT6.0"
FT                   /db_xref="taxon:9913"
FT   gene            1..1590
FT                   /gene="LRRC61"
FT   CDS_pept        230..1015
FT                   /codon_start=1
FT                   /gene="LRRC61"
FT                   /product="leucine rich repeat containing 61"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2T9T5"
FT                   /protein_id="AAI11279.1"
FT                   /translation="MEPRGEKSGEADGVRVTPQLLKARSGEFALESILLLKLRGLGLVG
FT                   LGCLGDCLGLEWLDLSGNALTQLGPLASLRQLAVLNVADNRLTGLEPLAACENLQCLNA
FT                   AGNLLAGPAQLQCLAGLRGLERLRLRDPLARLSNPLCASPCYWASVRELLPGLKVLDGE
FT                   RVSGRGSDFYQLCRDLDSSLSPDPGAPGPRPMEAQPWVEPGYWEALPPRSSSILEEACR
FT                   QFQDTLQECHDLDRQAWDSLAQAMRALSPAGATAASFVF"
XX
SQ   Sequence 1590 BP; 296 A; 521 C; 499 G; 274 T; 0 other;
     ggttgttggt ggaggggcgc gggcgtcccg tttccgtcgg ccccgccggc cggcctgacc        60
     ctcggcagta gggacctgct ggccctcgag tgagggtgtc ggagacgtgt ccaatctggg       120
     cccaggctga gtgggggggg cgacccgtgg ggtgagcagc cctctgacca ccagtggcac       180
     ctgcatcgca gctgcctgac cccccggccc cctggcccca tttggtctca tggagcctcg       240
     gggcgagaag tcaggagagg ctgacggggt gcgcgtgacg ccccagctgc tcaaggcgcg       300
     ctcgggcgag tttgccctgg agtccatcct gctgctcaag ctgcggggcc tggggctggt       360
     gggcctgggc tgcctggggg actgcctcgg cctcgagtgg ctggacctgt cgggtaacgc       420
     gctcacccag ctgggcccgc tggcctccct gcggcagctg gccgtgctca acgtggctga       480
     caaccggctg acgggcctgg agcccctggc cgcctgtgag aacctgcagt gtctcaatgc       540
     tgcaggcaac ctgctggctg ggcccgcgca gctgcagtgc ctggcggggc tgcggggtct       600
     ggagcgcctg cggctccgag acccgttggc gcggctcagc aacccgctgt gcgccagccc       660
     ctgctactgg gcctcagtgc gtgagctgct gcccggcctg aaggtcctcg acggcgagcg       720
     tgtgagtggg cgcggcagcg acttctacca gctgtgccgg gacctcgaca gctccttgag       780
     ccccgaccct ggtgcccctg gcccccggcc catggaggcc cagccttggg tggagcctgg       840
     ctactgggag gccttgcccc cacgcagcag ctccatcctg gaggaggcct gccgccagtt       900
     ccaggacacg ctgcaggagt gccacgacct ggaccgccag gcctgggaca gcttggccca       960
     ggccatgcgg gcactcagcc ccgcgggcgc cactgccgcc tccttcgtct tctgaaggcg      1020
     ccccggggcc ctcggtggcc accctgcttg tctggacagt tttgtcccac tgcttgttgc      1080
     ccttcaagga aaactcccca cgtccatcaa agatgtacct ccctcgggcc ctccccaagc      1140
     agcgggctca gcctgaggct gtcctgctac cacctagaag agcgcctggg aggaggtccc      1200
     tggccccttc cacggctaca gctgctgcct gtcccagctg catgagcctg aggctcggag      1260
     gaagaaagca gcttggtcct aaggctgcag ctgggggagg aggggaaggc cagcctcctg      1320
     cccctcccgc cctgggagac gccgtggctg agcttgctgg cgtggaagct gcatttaccc      1380
     atctccctgg ttctcctgct gtgtcccttg ctcctgggtc tccctggaac ctccactgtc      1440
     cccattccca cccatgctca tccctattaa attgttttaa ttagtatcag tacaaaaaaa      1500
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1560
     aaaaaaaaaa aaagaaaaaa aaaaaaaaaa                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page