(data stored in ACNUC15260 zone)

EMBL: BC111907

ID   BC111907; SV 1; linear; mRNA; STD; MUS; 907 BP.
XX
AC   BC111907;
XX
DT   22-JAN-2006 (Rel. 86, Created)
DT   22-JAN-2006 (Rel. 86, Last updated, Version 1)
XX
DE   Mus musculus olfactory receptor 284, mRNA (cDNA clone IMAGE:40040258),
DE   partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-907
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-907
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-JAN-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 13d8ed8b6fc4d6d71b663dad6d80055e.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 15 Row: a Column: 14.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..907
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="IMAGE:40040258"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: ATAGGTAA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..907
FT                   /gene="Olfr284"
FT                   /note="synonym: MOR160-4"
FT   CDS_pept        <1..907
FT                   /codon_start=2
FT                   /gene="Olfr284"
FT                   /product="Olfr284 protein"
FT                   /db_xref="GOA:Q2M2M5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030118"
FT                   /db_xref="UniProtKB/TrEMBL:Q2M2M5"
FT                   /protein_id="AAI11908.1"
FT                   /translation="SAVHEFVLLGLSTDPHIQPALFVLFLLVYLLTVVGNSLMLLVIVA
FT                   DSHLHTPMYFFLRQLSFLDLCHSSVTAPKMLENLLSEEKTILVESCLAQAFFVFATGGT
FT                   EACLLAAMAYDRYVAIGSPLLYSQVMSSQLCVGLVWLSWCLAVVDALLNTLPAVSLDFC
FT                   EDQTISHFSCELSSLFPLSCSDTAANFTLLLCSSVVHFFGTLVMIVCSYGRIVTTVLRV
FT                   SSSTGRSKAFSTCLSHLTTVILFYGSGFISYLLPASGSPLEKVFSLQYSVITPMLNPLI
FT                   YSLKNKEVKAALGRMIRKHF"
XX
SQ   Sequence 907 BP; 152 A; 281 C; 209 G; 265 T; 0 other;
     cagcgctgtc catgagtttg ttcttctagg actatccacc gacccccaca ttcaacctgc        60
     actctttgtc ctgttccttc tggtttacct cctcaccgtg gtggggaact ccctgatgtt       120
     gcttgtgatt gtggccgatt cccacctcca cacacctatg tacttcttcc tgagacagct       180
     gtccttcctg gatctctgtc actcctctgt cacggcgccc aagatgctcg agaatctact       240
     ctctgaggag aaaaccatct tggttgaaag ctgcttggct caggccttct tcgtcttcgc       300
     caccggcggc accgaggcct gtctgcttgc agcgatggcc tatgaccgct acgttgccat       360
     cggttcccct ttgctctaca gccaggtgat gagtagccag ctctgtgtgg ggctggtgtg       420
     gctctcctgg tgtctggctg ttgtggatgc tctcctcaat accctcccgg ctgtcagttt       480
     agatttctgt gaggaccaaa cgatttctca cttcagctgt gagctgtctt ctctcttccc       540
     tctgtcttgc tctgacaccg ccgccaactt cacactcctg ctctgctcct ccgtcgtgca       600
     tttctttgga acgcttgtca tgattgtttg ctcttatggc cgcattgtca ccactgtcct       660
     gagggtcagc tccagcacgg ggagaagcaa ggccttctcc acctgtttgt cccatctcac       720
     taccgtcatc ttgttctatg gctcggggtt tatcagttat ctcttaccgg cttcagggtc       780
     ccccctggag aaggtcttct ctctgcagta cagcgtcatc acccccatgc tgaaccccct       840
     catctacagc ctgaagaaca aggaggtgaa ggcagcgctg ggaagaatga tcagaaagca       900
     tttttag                                                                 907
//

If you have problems or comments...

PBIL Back to PBIL home page