(data stored in ACNUC10964 zone)

EMBL: BC112867

ID   BC112867; SV 1; linear; mRNA; STD; MAM; 1447 BP.
XX
AC   BC112867;
XX
DT   08-FEB-2006 (Rel. 86, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Bos taurus sorting nexin 8, mRNA (cDNA clone MGC:137391 IMAGE:8172168),
DE   complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-1447
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (31-JAN-2006) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; 243be855106993eb876d980bda0985e2.
DR   Ensembl-Gn; ENSBTAG00000013708; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000018213; bos_taurus.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: Y. Meng, M. Taniguchi, S. Lobo, L. Guan and S.
CC   Moore
CC   cDNA Library Preparation: M. Masaaki, Y. Meng, S. Lobo,  L. Guan
CC   and Dr. S. Moore
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Tanaguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Chun E, Liao N, Beland J, Cruz K, Featherstone R, Kirk H,
CC   Matsuo C, Mayo M, Moore R, Munro S, Roger J, Tam B, Trinh E, Sze W,
CC   Wilton J, Wanger S, Huang P, Chu B, Imanian B, Roscoe R, Holt R,
CC   Jones S, Marra M
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 263 Row: j Column: 6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1447
FT                   /organism="Bos taurus"
FT                   /lab_host="DH10B"
FT                   /strain="Hereford"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-12"
FT                   /clone="MGC:137391 IMAGE:8172168"
FT                   /tissue_type="Heart ventrical, 8.5 month female Hereford"
FT                   /note="Vector: pCMV-SPORT6.0"
FT                   /db_xref="taxon:9913"
FT   gene            1..1447
FT                   /gene="SNX8"
FT   CDS_pept        2..1381
FT                   /codon_start=1
FT                   /gene="SNX8"
FT                   /product="sorting nexin 8"
FT                   /db_xref="GOA:Q2KHV6"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR028662"
FT                   /db_xref="InterPro:IPR035704"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2KHV6"
FT                   /protein_id="AAI12868.1"
FT                   /translation="MTGGAMDPLPTAPGAAAAEAEVDEEADPPAADSPVPPVSEPRAPD
FT                   AGQMQVPPGNPLLLSLTLQELLARDAVQVELVPEKKGLFLKHVEYEVSSQRFKSCVYRR
FT                   YNDFVVFHETLLHKFPYRMVPALPPKRMLGADREFIEARRRALKRFINLVARHPPFSED
FT                   TILKLFLSFSGPDVQNKLKESAQCLGDEFMNCRLAARAKDFLPADIQTQFAMSRELIRN
FT                   IYNSFHKLRDRAERMVSRAIDNAADLLIFGKELSALGSDTTPLPSWASLNSSTWGSLKQ
FT                   ALKGLSVEFALLADKAAQQGKQEENDVVEKLNLFLDLLQSYKDLCERHEKGVLHKHQRA
FT                   LHKYSLMKRQMVSAAVQSREPESMEQLESRIVQQENVIQTMELRSHFSLYCLHQETQLV
FT                   HVYLPLTSHILGAFVNSQIQGHKEMSKVWNDLQPKLRCLFVGPHGAPAPPRPPQDGLSA
FT                   H"
XX
SQ   Sequence 1447 BP; 294 A; 467 C; 453 G; 233 T; 0 other;
     gatgaccggc ggcgcgatgg acccgctgcc caccgcgccc ggagctgcag ctgctgaggc        60
     ggaggtggac gaggaggcgg acccgccagc ggcagactcg ccagtgcccc cggtcagcga       120
     gcccagggcc ccggacgccg gtcagatgca ggtgccgccg gggaacccgc tgctgctgtc       180
     gctgactctg caggagctgc tggccaggga tgccgtgcag gtggagctcg tccccgagaa       240
     gaaaggcctg ttcctgaagc acgtggagta tgaggtgtcc agccagcgct tcaagtcctg       300
     cgtgtaccgc cgctacaacg acttcgtggt cttccacgag acgctgctgc acaagttccc       360
     gtaccgcatg gtgcctgccc tgccgcccaa gaggatgctg ggagccgaca gggagttcat       420
     cgaggcccgg aggcgggcgc tgaagcgctt catcaacttg gtggcccggc acccgccctt       480
     ctctgaggac acgatcctca agctgttcct gtccttcagc ggccccgacg tgcagaacaa       540
     gttgaaggaa tctgctcagt gtctgggaga cgagttcatg aactgcaggc tggcggctcg       600
     ggccaaggac ttcctcccgg ccgacatcca gacccagttc gccatgagcc gcgagctcat       660
     tcgaaacatc tacaacagct ttcacaagct ccgtgatcgg gccgagcgga tggtgtcacg       720
     ggccatcgac aacgccgcag accttctcat attcgggaag gagctgagtg ctctagggtc       780
     tgacacgacc ccactcccct cctgggcctc gctgaacagt agcacatggg ggtccctcaa       840
     acaggcgctg aaaggcctgt ccgtggagtt cgcgctgctg gctgacaagg ccgcacagca       900
     gggcaaacag gaggagaacg acgtggtgga gaagctgaac ctcttcctgg acttgttgca       960
     gtcctacaaa gacctgtgcg agcggcacga gaagggtgtg ctgcacaagc accagcgggc      1020
     gctgcacaag tacagcctga tgaagcggca gatggtgagc gccgccgtgc agagccgcga      1080
     gcccgagtcc atggagcagc tggagtcccg tatcgtgcag caggagaacg tgatccagac      1140
     catggagctc cgcagtcact tctcgctgta ctgcctgcac caggagacgc agctggtgca      1200
     cgtgtacctg ccgctcacct cccacatcct cggggccttc gtcaactccc agatccaagg      1260
     gcacaaggag atgagcaagg tgtggaacga cctgcagccc aagctgcgct gcctcttcgt      1320
     gggaccgcac ggcgccccgg cccccccgag gcccccccag gacggcctgt ctgctcacta      1380
     gtgcccggag ggctcagaga cagcttggcg ccctcactaa agcctctttc caaaaaaaaa      1440
     aaaaaaa                                                                1447
//

If you have problems or comments...

PBIL Back to PBIL home page