(data stored in ACNUC21562 zone)

EMBL: BC115741

ID   BC115741; SV 1; linear; mRNA; STD; MUS; 1259 BP.
XX
AC   BC115741;
XX
DT   16-APR-2006 (Rel. 87, Created)
DT   16-APR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Mus musculus MAS-related GPR, member A4, mRNA (cDNA clone MGC:140990
DE   IMAGE:40045594), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1259
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1259
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (14-APR-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a207c6b750673e20e8a61b1ef6cd7558.
DR   Ensembl-Gn; ENSMUSG00000067173; mus_musculus.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032769; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032786; mus_musculus_nzohlltj.
DR   Ensembl-Tr; ENSMUST00000087092; mus_musculus.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084577; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084853; mus_musculus_nzohlltj.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 20 Row: e Column: 4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1259
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:140990 IMAGE:40045594"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: ATTTAACG"
FT                   /db_xref="taxon:10090"
FT   gene            1..1259
FT                   /gene="Mrgpra4"
FT                   /note="synonym: MrgA4"
FT   CDS_pept        245..1186
FT                   /codon_start=1
FT                   /gene="Mrgpra4"
FT                   /product="MAS-related GPR, member A4"
FT                   /db_xref="GOA:Q91WW2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026233"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:3033100"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91WW2"
FT                   /protein_id="AAI15742.1"
FT                   /translation="MAPTTTNPMNETIPGSIDIETLIPNLMIIIFGLVGLTGNVILFWL
FT                   LGFHLHRNAFLVYILNLALADFLFLLCHIINSTMLLLKVHLPNNILNHCFDIIMTVLYI
FT                   TGLSMLSAISTERCLSVLCPIWYRCRRPEHTSTVLCAVIWFLPLLICILNGYFCHFFGP
FT                   KYVIDSVCLATNFFIRTYPMFLFIVLCLSTLALLARLFCGAGKTKFTRLFVTIMLTVLV
FT                   FLLCGLPLGFFWFLVPWINRDFSVLDYILFQTSLVLTSVNSCANPIIYFFVGSFRHRLK
FT                   HKTLKMVLQSALQDTPETPENMVEMSRSKAEP"
XX
SQ   Sequence 1259 BP; 317 A; 317 C; 263 G; 362 T; 0 other;
     ggagggagga tgagatgggg gtttccagga aggggggaag caggaaaggg gataacattt        60
     taaatttaaa tatagaaaat atccaataca aaacattttg aacaaacaac aaaaaactca       120
     caaaaacaac aacaacaaaa aaaagaaatt aaaagttgtg ttcatagtga aggcctcatt       180
     tcttctttgt gttcccagca acaccagtgc agggtttctg gccctaaaca cctcagcctc       240
     ggcaatggca cccacaacaa caaatccaat gaacgaaacc atccctggaa gtattgacat       300
     cgagaccctg atcccaaact tgatgatcat catcttcgga ctggtcgggc tgacaggaaa       360
     tgtcattttg ttttggctcc tgggcttcca cttgcacagg aatgccttct tagtctacat       420
     cctaaacttg gccctggctg acttcctctt ccttctctgt cacatcataa attccacaat       480
     gcttcttctc aaggttcacc tacccaacaa tattttgaac cattgctttg acatcatcat       540
     gacagttctc tacatcacag gcctgagcat gctcagtgcc atcagcactg agcgctgcct       600
     gtctgtcctg tgccccatct ggtatcggtg ccgccgccca gaacacacat caactgtcct       660
     gtgtgctgtg atctggttcc tgcccctgtt gatctgcatt ctgaatggat atttctgtca       720
     tttctttggt cccaaatatg taattgactc tgtgtgtctg gcaacgaact tctttatcag       780
     aacatacccg atgtttttgt ttatagtcct ctgtctgtcc accctggctc tgctggccag       840
     gttgttctgt ggtgctggga agacgaaatt taccagatta ttcgtgacca tcatgctgac       900
     cgttttggtt tttcttctct gtgggttgcc cctgggcttc ttctggtttc tggtgccctg       960
     gattaaccgt gatttcagtg tactagatta tatacttttt cagacatcac ttgtcctaac      1020
     ttctgttaac agctgtgcca accccatcat ttacttcttt gtgggctcct tcaggcatcg      1080
     gttgaagcac aagaccctca aaatggttct ccagagtgca ttgcaggaca ctcctgagac      1140
     acctgaaaac atggtggaga tgtcaagaag caaagcagag ccgtgatgaa gagcctctac      1200
     ctggacctca gaggtggctt tggattgagc actgccctgc tgcacttgac cactgtcca       1259
//

If you have problems or comments...

PBIL Back to PBIL home page