(data stored in ACNUC21562 zone)

EMBL: BC116696

ID   BC116696; SV 1; linear; mRNA; STD; MUS; 1439 BP.
XX
AC   BC116696;
XX
DT   01-JUL-2006 (Rel. 88, Created)
DT   01-JUL-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Mus musculus MAS-related GPR, member H, mRNA (cDNA clone MGC:144746
DE   IMAGE:40105568), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1439
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1439
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-MAY-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 850f3725b1a2bb3c46232b331be78360.
DR   Ensembl-Gn; ENSMUSG00000059408; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023151; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023119; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023083; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023119; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022882; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023562; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022396; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022854; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022987; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022957; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023059; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022976; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023588; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022144; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022453; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000075296; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045559; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0045542; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0045494; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045502; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045252; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0045987; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045366; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0045167; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0045308; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0045268; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0045395; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045245; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046056; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0044949; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044636; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 25 Row: j Column: 10.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1439
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:144746 IMAGE:40105568"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: TATAAG"
FT                   /db_xref="taxon:10090"
FT   gene            1..1439
FT                   /gene="Mrgprh"
FT                   /note="synonym: MrgH"
FT   CDS_pept        472..1437
FT                   /codon_start=1
FT                   /gene="Mrgprh"
FT                   /product="MAS-related GPR, member H"
FT                   /db_xref="GOA:Q99MT8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026221"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:1934134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99MT8"
FT                   /protein_id="AAI16697.1"
FT                   /translation="MEPLAMTLYPLESTQPTRNKTPNETTWSSEHTDDHTYFLVSLVIC
FT                   SLGLAGNGLLIWFLIFCIKRKPFTIYILHLAIADFMVLLCSSIMKLVNTFHIYNMTLES
FT                   YAILFMIFGYNTGLHLLTAISVERCLSVLYPIWYQCQRPKHQSAVACMLLWALSVLVSG
FT                   LENFFCILEVKPQFPECRYVYIFSCILTFLVFVPLMIFSNLILFIQVCCNLKPRQPTKL
FT                   YVIIMTTVILFLVFAMPMKVLLIIGYYSSSLDDSVWDSLPYLNMLSTINCSINPIVYFV
FT                   VGSLRRKRSRKSLKEALQKVFEEKPVVASRENVTQFSLPS"
XX
SQ   Sequence 1439 BP; 347 A; 392 C; 328 G; 372 T; 0 other;
     aaccacaacc agcagcagga ggagagcagc agcctcctcc tttcttgggg ctgtgtcccc        60
     agccacagtt taaatcattt caatgtattg ccatgtatca ctttaaaact cctaattctg       120
     tcacctcgtt ctggtaagaa ctcctagaca taagaaacac agagagcttt cccagagagc       180
     cgtgaccaaa gaggaactgt tgtaggctga ggctgggagt cagccctagt gttagtagag       240
     gggatgtgga catttcagta gcgtctgctg agtggagagc tgacaaaggg ggaatgagcc       300
     agggcatgaa gatgaggaga gagggcgggg gactctggcg tccctgtccc tcagcatggg       360
     agagaagcct ccccatgata caaaaccgtt ctgaggtgca gaacagatgg cgccggtcac       420
     caccttctgt ttctgatcac aggaggccac agagaaagcc atcttcctgg aatggagcca       480
     ttggcaatga ccttgtatcc tctggaatcc acacaaccca ccagaaacaa aaccccaaat       540
     gaaaccacct ggtcttcaga gcatacggat gaccacactt acttcttagt ctccctggtc       600
     atttgttccc tgggactggc tgggaatggc cttttgatat ggttcctaat cttctgtatc       660
     aagaggaagc cattcaccat ctacatcctc catctcgcca ttgcagactt catggtcctc       720
     ctctgttcgt ccatcatgaa gctagtgaac acttttcaca tctacaatat gaccttagag       780
     agctacgcca tcctcttcat gatctttggc tacaacacag ggctccacct cctcacggcc       840
     atcagcgtag agcggtgcct ctccgtgctt tatccaatct ggtaccagtg ccaacgccca       900
     aaacaccagt ccgctgtggc ctgtatgctg ctgtgggccc tctctgttct cgtgtctggt       960
     ttggaaaact tcttctgcat tctggaagtg aagccccaat tcccagaatg ccgatacgtg      1020
     tacatattct cctgtatctt gactttcctg gtcttcgttc ctctcatgat cttctctaat      1080
     ttgatcctct tcatccaagt ctgctgtaac ctgaagccac gtcaaccgac caagctctat      1140
     gtgatcatca tgaccacggt catcctgttt cttgtcttcg ccatgcccat gaaggtgttg      1200
     cttatcatcg gctactattc tagttctctt gatgattctg tatgggactc cctcccctac      1260
     ctgaacatgc tgtccactat aaactgcagc atcaacccaa ttgtctactt tgtggtaggc      1320
     agcctgagga ggaagaggag taggaagtcc ctaaaagaag cactgcagaa agtcttcgag      1380
     gaaaagccag tggtggcctc gagggagaat gtgacacagt tctcgctgcc ttcatgacc       1439
//

If you have problems or comments...

PBIL Back to PBIL home page