(data stored in ACNUC15260 zone)

EMBL: BC116954

ID   BC116954; SV 1; linear; mRNA; STD; MUS; 1012 BP.
XX
AC   BC116954;
XX
DT   01-JUL-2006 (Rel. 88, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus olfactory receptor 402, mRNA (cDNA clone MGC:151331
DE   IMAGE:40126273), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1012
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1012
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-MAY-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; cc675552b31e6ea8d646d6df0413ad96.
DR   Ensembl-Gn; ENSMUSG00000070379; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018686; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018652; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018622; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018626; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018439; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019077; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017992; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018410; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018518; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018508; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018589; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018534; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019117; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017763; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018046; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000073675; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216722; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0030614; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0030548; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0030529; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030546; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030342; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031055; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030045; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0030256; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0030389; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0030388; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0030511; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030373; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031077; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0029761; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0029825; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 1 Row: J Column: 10.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1012
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_389"
FT                   /clone="MGC:151331 IMAGE:40126273"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: AGATTGCA"
FT                   /db_xref="taxon:10090"
FT   gene            1..1012
FT                   /gene="Olfr402"
FT                   /note="synonyms: MOR255-4, RP23-20M18.2"
FT   CDS_pept        42..989
FT                   /codon_start=1
FT                   /gene="Olfr402"
FT                   /product="olfactory receptor 402"
FT                   /db_xref="GOA:Q8VFX8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030236"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFX8"
FT                   /protein_id="AAI16955.1"
FT                   /translation="MQTKPRINGTTITEFILLGLVETPELWPLVFILFLLAYMTTVGGN
FT                   LSILAAVLVEPKLHTPMYFFLGNLSVMDVGCISVTIPSMLVRLLVQKHTIPYGDCLTQL
FT                   FFFHLLAGVDCFLLTAMAYDRFLAICQPLTYSTRMNYTIQRILVAMSWACAFSNALTHT
FT                   VAISTLHFCGPNVINHFYCDLPQLFQLSCSSTQLNELLLFGVGFIMAGTPMALIFISYI
FT                   HVAAAVLRIRSAEGRKKAFSTCSSHLTVVAMFYGTGMFNYMRLGSTKFSDKDKAIGIFN
FT                   TVINPMLNPLIYSLRNPDVQAALWRVLTGRRPAA"
XX
SQ   Sequence 1012 BP; 226 A; 280 C; 219 G; 287 T; 0 other;
     cctgtggttt ttcctccttg catgcttctt taaaggaact catgcagaca aagcctagaa        60
     tcaatggaac cactattact gaattcattc ttctgggttt ggtggagaca ccagagctgt       120
     ggccacttgt cttcatactc ttcctcttgg cttacatgac aacagttgga ggtaacctga       180
     gcatcctggc agctgtcttg gtggaaccca aactgcacac tcccatgtac ttcttcctgg       240
     ggaatctgtc agtgatggat gtggggtgca tcagtgtcac tattccctcc atgttggttc       300
     ggctcttggt ccaaaagcat acaattccat atggagactg cctcacacag ctcttcttct       360
     tccatctgct ggctggggtt gactgtttcc tgttgacagc catggcttat gaccgcttcc       420
     tggccatctg ccagcccctc acttacagca cccgaatgaa ctacactata cagaggatct       480
     tggtggctat gtcctgggct tgtgccttta gcaatgcact gacacacaca gtagccatat       540
     ccacacttca cttctgtggc ccaaatgtaa tcaatcactt ctactgtgac ctgcctcagc       600
     tcttccagct gtcctgctcc agtacccagc tcaatgagct gctgctcttt ggagtgggtt       660
     tcataatggc aggaacccct atggcactca tttttatctc ttatatccat gtggcagctg       720
     cagttctgcg aattcgctct gctgaaggca gaaagaaagc tttctccaca tgcagctctc       780
     acctcactgt ggttgccatg ttctatggca caggcatgtt taactacatg agactgggtt       840
     ccaccaaatt ttcagataag gacaaagcta ttgggatttt caacactgtc atcaacccta       900
     tgctgaaccc actcatctac agtctcagga accctgatgt gcaggctgcc ctctggaggg       960
     tactcacagg gagacggcca gcagcttgaa gaggtctcaa ggtcccttcc ac              1012
//

If you have problems or comments...

PBIL Back to PBIL home page