(data stored in ACNUC21562 zone)

EMBL: BC117525

ID   BC117525; SV 1; linear; mRNA; STD; MUS; 1437 BP.
XX
AC   BC117525;
XX
DT   01-JUL-2006 (Rel. 88, Created)
DT   01-JUL-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Mus musculus MAS-related GPR, member H, mRNA (cDNA clone MGC:144745
DE   IMAGE:40105567), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1437
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1437
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-JUN-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 4fa99302e9450c3afc8008ff3577a5d2.
DR   Ensembl-Gn; ENSMUSG00000059408; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023151; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023119; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023083; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023119; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022882; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023562; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022396; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022854; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022987; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022957; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023059; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022976; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023588; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022144; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022453; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000075296; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045559; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0045542; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0045494; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045502; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045252; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0045987; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045366; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0045167; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0045308; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0045268; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0045395; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045245; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046056; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0044949; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044636; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 25 Row: j Column: 9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1437
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:144745 IMAGE:40105567"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: GGTTGTTC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1437
FT                   /gene="Mrgprh"
FT                   /note="synonym: MrgH"
FT   CDS_pept        470..1435
FT                   /codon_start=1
FT                   /gene="Mrgprh"
FT                   /product="MAS-related GPR, member H"
FT                   /db_xref="GOA:Q99MT8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026221"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:1934134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99MT8"
FT                   /protein_id="AAI17526.1"
FT                   /translation="MEPLAMTLYPLESTQPTRNKTPNETTWSSEHTDDHTYFLVSLVIC
FT                   SLGLAGNGLLIWFLIFCIKRKPFTIYILHLAIADFMVLLCSSIMKLVNTFHIYNMTLES
FT                   YAILFMIFGYNTGLHLLTAISVERCLSVLYPIWYQCQRPKHQSAVACMLLWALSVLVSG
FT                   LENFFCILEVKPQFPECRYVYIFSCILTFLVFVPLMIFSNLILFIQVCCNLKPRQPTKL
FT                   YVIIMTTVILFLVFAMPMKVLLIIGYYSSSLDDSVWDSLPYLNMLSTINCSINPIVYFV
FT                   VGSLRRKRSRKSLKEALQKVFEEKPVVASRENVTQFSLPS"
XX
SQ   Sequence 1437 BP; 345 A; 392 C; 328 G; 372 T; 0 other;
     ccacaaccag cagcaggagg agagcagcag cctcctcctt tcttggggct gtgtccccag        60
     ccacagttta aatcatttca atgtattgcc atgtatcact ttaaaactcc taattctgtc       120
     acctcgttct ggtaagaact cctagacata agaaacacag agagctttcc cagagagccg       180
     tgaccaaaga ggaactgttg taggctgagg ctgggagtca gccctagtgt tagtagaggg       240
     gatgtggaca tttcagtagc gtctgctgag tggagagctg acaaaggggg aatgagccag       300
     ggcatgaaga tgaggagaga gggcggggga ctctggcgtc cctgtccctc agcatgggag       360
     agaagcctcc ccatgataca aaaccgttct gaggtgcaga acagatggcg ccggtcacca       420
     ccttctgttt ctgatcacag gaggccacag agaaagccat cttcctggaa tggagccatt       480
     ggcaatgacc ttgtatcctc tggaatccac acaacccacc agaaacaaaa ccccaaatga       540
     aaccacctgg tcttcagagc atacggatga ccacacttac ttcttagtct ccctggtcat       600
     ttgttccctg ggactggctg ggaatggcct tttgatatgg ttcctaatct tctgtatcaa       660
     gaggaagcca ttcaccatct acatcctcca tctcgccatt gcagacttca tggtcctcct       720
     ctgttcgtcc atcatgaagc tagtgaacac ttttcacatc tacaatatga ccttagagag       780
     ctacgccatc ctcttcatga tctttggcta caacacaggg ctccacctcc tcacggccat       840
     cagcgtagag cggtgcctct ccgtgcttta tccaatctgg taccagtgcc aacgcccaaa       900
     acaccagtcc gctgtggcct gtatgctgct gtgggccctc tctgttctcg tgtctggttt       960
     ggaaaacttc ttctgcattc tggaagtgaa gccccaattc ccagaatgcc gatacgtgta      1020
     catattctcc tgtatcttga ctttcctggt cttcgttcct ctcatgatct tctctaattt      1080
     gatcctcttc atccaagtct gctgtaacct gaagccacgt caaccgacca agctctatgt      1140
     gatcatcatg accacggtca tcctgtttct tgtcttcgcc atgcccatga aggtgttgct      1200
     tatcatcggc tactattcta gttctcttga tgattctgta tgggactccc tcccctacct      1260
     gaacatgctg tccactataa actgcagcat caacccaatt gtctactttg tggtaggcag      1320
     cctgaggagg aagaggagta ggaagtccct aaaagaagca ctgcagaaag tcttcgagga      1380
     aaagccagtg gtggcctcga gggagaatgt gacacagttc tcgctgcctt catgacc         1437
//

If you have problems or comments...

PBIL Back to PBIL home page