(data stored in ACNUC8465 zone)

EMBL: BC118335

ID   BC118335; SV 1; linear; mRNA; STD; MAM; 1707 BP.
XX
AC   BC118335;
XX
DT   27-JUN-2006 (Rel. 88, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Bos taurus ras homolog gene family, member V, mRNA (cDNA clone MGC:139981
DE   IMAGE:8285463), complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-1707
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (23-JUN-2006) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; 044a072a102663f1710bb9f75926dad6.
DR   Ensembl-Gn; ENSBTAG00000053721; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000083826; bos_taurus.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: Lee Alexander, USDA, ARS, NPA
CC   cDNA Library Preparation: Express Genomics
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Tanaguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Chun E, Liao N, Beland J, Cruz K, Featherstone R, Kirk H,
CC   Matsuo C, Mayo M, Moore R, Munro S, Roger J, Tam B, Trinh E, Sze W,
CC   Wilton J, Wanger S, Huang P, Chu B, Imanian B, Roscoe R, Holt R,
CC   Jones S, Marra M
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 269 Row: n Column: 20.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1707
FT                   /organism="Bos taurus"
FT                   /lab_host="DH10B"
FT                   /strain="L1 Hereford"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-29"
FT                   /clone="MGC:139981 IMAGE:8285463"
FT                   /tissue_type="Fetal skin , female fetus 6 months, L1
FT                   Hereford"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:9913"
FT   gene            1..1707
FT                   /gene="RHOV"
FT   CDS_pept        75..785
FT                   /codon_start=1
FT                   /gene="RHOV"
FT                   /product="ras homolog gene family, member V"
FT                   /db_xref="GOA:Q17QI8"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q17QI8"
FT                   /protein_id="AAI18336.1"
FT                   /translation="MPPRELSEAESSPLRSPTPPPGRGSASPELGIKCVLVGDGAVGKS
FT                   SLIVSYTCNGYPARYRPTALDTFSVQVLVDGAPVRIELWDTAGQEDLDRLRSLCYPDTD
FT                   VFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGRE
FT                   GPVPQPQAQGLAEKIRACCYLECSALTQKNLKEVFDSAILSAIEHKARLEKKLNAKGVR
FT                   TLSRCRWKKFFCFV"
XX
SQ   Sequence 1707 BP; 402 A; 448 C; 531 G; 326 T; 0 other;
     gtcagaggca acctacggaa cgtgcttcac cgatcacagc ggagcctggt cctcggctgt        60
     ccccggagcg ggtcatgccc ccgcgggagc taagcgaagc cgagtcgtcc ccgctccgat       120
     ccccgacccc tcccccggga cggggcagcg cctcccccga gctgggcata aagtgcgtgc       180
     tggtgggcga cggcgcggtg ggcaagagca gccttatcgt cagctacacc tgcaatgggt       240
     accccgcgcg ctaccggccc acagcgctgg acaccttctc cgtgcaagtc ctggttgatg       300
     gagccccggt gcgcattgag ctctgggaca cagcgggaca ggaagacctt gaccgccttc       360
     gctccctctg ctacccggat acagatgtct tcctggcctg cttcagtgtg gtgcagccca       420
     gctccttcca aaacatcaca gagaaatggc tgccagagat tcgtactcac aatccccagg       480
     cgcccgtgct gctggtgggt acccaggccg acctgaggga tgatgtcaat gtactgattc       540
     agctggacca ggggggccgg gaaggcccgg tgcctcaacc ccaggctcag ggtctggccg       600
     agaagatccg ggcctgctgc tacctggagt gctctgcctt gacgcagaag aacttgaaag       660
     aggtgtttga ctcggccatt ctcagtgcca ttgagcacaa agcccggctg gagaagaaac       720
     tgaacgccaa aggtgtgcgc actctctccc gctgccgctg gaagaagttc ttctgttttg       780
     tttgaacagc tgtggcagca aaatgatcag taggccaatg gccacagact tctagaacct       840
     gagacatggg gcctttgaga ggctctgctg gcagggccag gccaccccca tgggactcag       900
     ttcccgtctg aacgctgtgg agccatgggc ctttaactgc ccgctcttcc atgctagggt       960
     gagcctaggg cctggatggg ggaaggctct gacttggatt tctgtggtca aggctgacag      1020
     agaaatccta gtactttgat tttcatggga tgatcctgac agtgtcagct gcctccaagc      1080
     agtttgggat ccaattccca ttttcttatt atgggccctc aagccagcct ggctgaatta      1140
     agaccccttg tggtggtccc caccctttcc ttggcccagg ggtgaggaag agcctgagga      1200
     acagctgggc atctcggaag gctggaaggt gtccagccct gatttggaga gtttagaatg      1260
     aattgactaa gacagaggtc tgtgagagat tgagaaggag cagaaagtac agccttggag      1320
     ccttaggact agaggcaggc tggggagaag acagatcaga gggcttctct tggaacgaag      1380
     aagagaaagg agagtagaga agtggggcag ctgaggagca aggctgacac ttgggctgtc      1440
     ctcaaagcct caaggccagg gagggcgggg ctggtgcctg agaagaactg ggtctcgggg      1500
     ctccctaggc actgcccaaa ctggctggac aggagtggtg caggaagtga gaggcaaggc      1560
     ccagcaagag gagggggagg agctgcaaat cggagcctaa aggaagaagg ggctttctcc      1620
     aaaatcatag cctagaagac agggcaatgt ggaatctgca aataaagcct taagtttctg      1680
     aaaaaaaaaa aaaaaaaaaa aaaaaaa                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page