(data stored in ACNUC8465 zone)

EMBL: BC118362

ID   BC118362; SV 1; linear; mRNA; STD; MAM; 1636 BP.
XX
AC   BC118362;
XX
DT   27-JUN-2006 (Rel. 88, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Bos taurus mitogen-activated protein kinase kinase 2, mRNA (cDNA clone
DE   MGC:140486 IMAGE:8195206), complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-1636
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (23-JUN-2006) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; 541b013492c2a531aab2f18286ab2e8d.
DR   Ensembl-Gn; ENSBTAG00000024450; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000011377; bos_taurus.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: M. Taniguchi, Y. Meng, S. Lobo, L. Guan and S.
CC   Moore
CC   cDNA Library Preparation: M. Masaaki, Y. Meng, S. Lobo,  L. Guan
CC   and Dr. S. Moore
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Tanaguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Chun E, Liao N, Beland J, Cruz K, Featherstone R, Kirk H,
CC   Matsuo C, Mayo M, Moore R, Munro S, Roger J, Tam B, Trinh E, Sze W,
CC   Wilton J, Wanger S, Huang P, Chu B, Imanian B, Roscoe R, Holt R,
CC   Jones S, Marra M
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 266 Row: c Column: 10.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1636
FT                   /organism="Bos taurus"
FT                   /lab_host="DH10B"
FT                   /strain="Hereford"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-14"
FT                   /clone="MGC:140486 IMAGE:8195206"
FT                   /tissue_type="Fetal liver, 6 month male fetus, Hereford"
FT                   /note="Vector: pCMV-SPORT6.0"
FT                   /db_xref="taxon:9913"
FT   gene            1..1636
FT                   /gene="MAP2K2"
FT   CDS_pept        264..1466
FT                   /codon_start=1
FT                   /gene="MAP2K2"
FT                   /product="MAP2K2 protein"
FT                   /db_xref="GOA:Q17QH2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q17QH2"
FT                   /protein_id="AAI18363.1"
FT                   /translation="MLARRKPVLPALTINPAIAEGPSPTSEGASEAHLVDLQKKLEELE
FT                   LDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIH
FT                   LEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAK
FT                   RIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDS
FT                   MANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGR
FT                   PMVDGAEGEPPSISPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTQ
FT                   DFQEFVNKCLIKNPAERADLKMLMNHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTA
FT                   V"
XX
SQ   Sequence 1636 BP; 330 A; 549 C; 486 G; 271 T; 0 other;
     tgctcccggg ctcctgctgc agcgtcagcc cctgtccggc ttcggtggct gcggcggccc        60
     cgatcccgtg gcttcagccc cggcgacctt tggggcccct cggcccagat ccgcagcacc       120
     gcccatcttc gtcgcctcgg cgccggccta ggccgcggcc gcagccccgg gctcgcgtcg       180
     gtgccgcccg ctcccggccc gccccctatg ggccccggct agaggcgccg ccgccgccgc       240
     cgccgccggc ccgcggagcc ccgatgctgg cccggaggaa gccggtgctg ccggcgctca       300
     ccatcaaccc cgccatcgcc gagggcccgt cccctaccag cgagggcgcc tccgaagcac       360
     atctggtgga cctccagaag aagctagagg agctagagct cgacgagcag cagaagaagc       420
     ggctggaagc cttccttacc cagaaggcca aggttggtga gctcaaggac gatgactttg       480
     aacggatctc cgagctggga gccggcaatg gcggagtggt caccaaggtc cagcacagac       540
     cttcgggcct catcatggcc agaaagctga tccacctgga gatcaagccg gccatccgga       600
     accagatcat ccgagagcta caggtgctgc atgagtgcaa ctccccgtac attgtgggct       660
     tctacggggc cttctacagc gacggcgaga tcagcatctg catggagcac atggatggcg       720
     gctccctgga ccaggtgttg aaagaagcca agagaatccc tgaagagatc ctgggcaagg       780
     tcagcattgc ggttctgcgg ggcctggcat acctccggga gaaacaccag atcatgcacc       840
     gagacgtgaa gccgtccaac atcctggtca actcccgggg ggagatcaag ctgtgtgact       900
     tcggggtgag cggccagctc atcgactcca tggccaactc cttcgtgggg acgcggtcct       960
     acatgtctcc ggagcggcta caaggcacac actactcggt gcagtcagac atctggagca      1020
     tgggcctgtc cctggtggaa ctgtccatcg gcaggtaccc catccccccg ccggacgcca      1080
     aggagctgga ggccatattc ggccggccca tggttgatgg cgcagaagga gaacctccta      1140
     gcatctctcc acggccgagg ccccctggac gccccatcag cggtcacggg atggacagcc      1200
     ggcctgccat ggcgatcttt gagctgctgg actacattgt gaacgagcct cctcccaagc      1260
     tgcccaacgg tgtgttcacc caggacttcc aggagtttgt aaataaatgc ctaattaaga      1320
     acccagctga gcgagcagac ctgaagatgc tcatgaacca caccttcatc aagcggtccg      1380
     aggtggaaga agtggatttt gctggctggt tgtgtaaaac actgcggcta aaccagccca      1440
     gcacgcccac acgcaccgcc gtgtgacggt ggtcctgctg ccgccaccag gccttccccc      1500
     ctgccccatc cctcctgcca tgccctccga ggggacgcac acgtggccct caggcccggg      1560
     gaggccgata ccgctgtgct gtcttctcag atcctgcttc cttaggttta aagaaaaaag      1620
     aaaaaaaaaa aaaaaa                                                      1636
//

If you have problems or comments...

PBIL Back to PBIL home page