(data stored in ACNUC15260 zone)

EMBL: BC119308

ID   BC119308; SV 1; linear; mRNA; STD; MUS; 1096 BP.
XX
AC   BC119308;
XX
DT   10-AUG-2006 (Rel. 88, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus olfactory receptor 61, mRNA (cDNA clone MGC:155624
DE   IMAGE:8734057), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1096
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1096
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-JUL-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 9ea1312bb563eea856d207b9968eecb0.
DR   Ensembl-Gn; ENSMUSG00000096069; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033184; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033166; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033098; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033167; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032881; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033678; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032211; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032853; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033006; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032958; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033100; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032991; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033698; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031916; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032322; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000084455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000210241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000211685; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087409; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087495; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087431; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087450; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087013; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0087954; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087540; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0086956; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087151; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0086996; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087182; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087033; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088252; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0086942; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086051; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 2 Row: L Column: 23.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1096
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:155624 IMAGE:8734057"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: TGACTGAT"
FT                   /db_xref="taxon:10090"
FT   gene            1..1096
FT                   /gene="Olfr61"
FT                   /note="synonyms: MOR253-1, IH7"
FT   CDS_pept        97..1032
FT                   /codon_start=1
FT                   /gene="Olfr61"
FT                   /product="olfactory receptor 61"
FT                   /db_xref="GOA:Q8VGM2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333885"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGM2"
FT                   /protein_id="AAI19309.1"
FT                   /translation="MMFSPNQTEVTEFILEGFSEHATLRLLLTGCFLSLYTIALMGNIV
FT                   IIALVTSSTGLHSPMYFFLCNLATMDIVCTSSVIPKALIGLVSEENTISFKGCMAQLFF
FT                   LLWSLSSELLLLTVMAYDRYVAICFPLHYSSRMSPQLCGALAVGVWSICAVNASVHTGL
FT                   MTRLSFCGPKVITHFFCEIPPLLLLSCSPTYINSVMTLVADAFYGCINFVLTLLSYGCI
FT                   IASVLRMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVTSVLYSI
FT                   LSPTLNPLIYTLRNKDVKLALGRLLPFFPK"
XX
SQ   Sequence 1096 BP; 231 A; 314 C; 235 G; 316 T; 0 other;
     tgaggtgctc aaggctggaa accagacttt gcagtggtaa actgtgatct tttctcaaag        60
     ccaacaaaca cagttgtgaa acacatattt tccttgatga tgttcagtcc caaccagaca       120
     gaagtgacag agtttatact agaagggttt tcagaacatg ctactctaag acttctcctg       180
     acaggctgct tcctgtccct ctacacaatc gctctaatgg gcaacattgt tatcattgct       240
     ttggtcacct ccagcactgg gctccacagt cccatgtact ttttcctgtg caacctggcc       300
     accatggaca ttgtgtgcac ctcctctgtg attcctaagg ccctgattgg cctagtgtct       360
     gaagaaaaca ccatctcctt caaaggatgc atggctcagc tcttctttct tctgtggtcc       420
     ttgtcttcgg agctgctgct gctcacggtc atggcctatg accgctatgt ggccatctgc       480
     tttcccctgc actacagctc tagaatgagc ccacagctct gtggggccct ggccgtgggt       540
     gtatggtcca tctgtgctgt gaatgcatct gtgcacactg gcctgatgac acggctgtca       600
     ttctgtggcc ccaaggtcat cacccacttc ttctgtgaga ttcccccact cctcctgctt       660
     tcctgtagtc ccacatacat taatagcgtt atgacacttg tggcagatgc cttttatggg       720
     tgcatcaact ttgtgctaac cttgttatcc tatggctgca tcattgccag tgttctgcgc       780
     atgcgttctg ctgagggcaa gaggaaggcc ttttctacct gttcatccca cctcatcgtg       840
     gtctcagtgt actactcatc tgtgttctgt gcctatgtca gtcctgcctc cagctacagc       900
     ccagaaagaa gcaaagttac ctccgtgctg tactcgatcc tcagcccaac cctgaacccc       960
     ctcatctata cactaaggaa caaggatgtc aaactcgccc tgggaagact cttgcccttt      1020
     ttccccaagt agatggagct gtgcagaata ttctcctgac ctggactact cctaaacgtg      1080
     ctttcctgag ggtagc                                                      1096
//

If you have problems or comments...

PBIL Back to PBIL home page