(data stored in ACNUC7820 zone)

EMBL: BC120846

ID   BC120846; SV 1; linear; mRNA; STD; MUS; 1003 BP.
XX
AC   BC120846;
XX
DT   08-AUG-2006 (Rel. 88, Created)
DT   08-AUG-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Mus musculus olfactory receptor 399, mRNA (cDNA clone MGC:156083
DE   IMAGE:40129769), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1003
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1003
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-AUG-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 83f96b2567181fd5630adad057308bb6.
DR   Ensembl-Gn; ENSMUSG00000043692; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018683; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018650; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018619; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018623; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018436; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019074; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017991; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018407; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018515; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018505; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018586; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018531; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019114; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017762; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018044; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000059440; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215915; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0030608; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0030546; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0030523; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030540; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030336; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031049; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030044; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0030250; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0030383; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0030381; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0030505; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030368; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031071; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0029760; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0029823; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 3 Row: P Column: 2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1003
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:156083 IMAGE:40129769"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: TGTGTCTA"
FT                   /db_xref="taxon:10090"
FT   gene            1..1003
FT                   /gene="Olfr399"
FT                   /note="synonyms: MOR255-1, RP23-221M24.2"
FT   CDS_pept        22..957
FT                   /codon_start=1
FT                   /gene="Olfr399"
FT                   /product="olfactory receptor 399"
FT                   /db_xref="GOA:Q7TRX3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030233"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRX3"
FT                   /protein_id="AAI20847.1"
FT                   /translation="MDLGTLGNDSCVSTFVLLGLTETPVLRPILFVIFLLAYVATLGGN
FT                   FSILAAIIIEPKLHTPMYFFLGNLSMLDVGCISVTVPAMLKHFLSNDRHIPYGACLSQL
FT                   FFFHLLAGADCFLLTVMAYDRYLAICHPLTYNTHMSWRIQKASVCLSCVFSFSNALTQT
FT                   VALSTLKFCGPNTINHFYCDLPQLFQLSCSSIQLNEQLLFVAAAFMGVVPLVLITVSYG
FT                   HVAAAVLRIRSAEGRKKAFSTCSSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGIGILN
FT                   TVISPMLNPLIYSLRNPDVQGALRKVLTGR"
XX
SQ   Sequence 1003 BP; 205 A; 277 C; 221 G; 300 T; 0 other;
     tgtcactggt ggaagagagg catggatctg ggaaccttgg gaaacgattc ctgtgtgagc        60
     acatttgtcc tactgggtct cacagagact ccagttttgc ggcccatcct ctttgtcatc       120
     ttccttcttg cttatgtagc tacgcttggt ggcaatttca gcatcctggc tgctatcatt       180
     atagagccca aactccacac tcccatgtat ttcttcttgg ggaacttgtc tatgctggat       240
     gttggatgca ttagtgtcac tgttcctgcc atgttgaaac attttctatc caatgacaga       300
     cacattccct atggggcctg cctctcacag ctcttcttct tccatctcct ggctggggca       360
     gactgcttcc ttctgactgt catggcctat gatcgttatc tggctatctg ccaccccctc       420
     acctacaaca cccatatgag ttggaggatt cagaaggcct cagtgtgcct gtcatgtgtg       480
     ttttccttta gtaatgcact gacccaaact gttgccttat ctactcttaa attctgtggt       540
     ccaaacacaa tcaaccactt ctactgtgac ctccctcagc tctttcagct ttcctgttcc       600
     agcatccaac tcaatgagca gctgctcttt gtagcagcag ccttcatggg tgtggtcccc       660
     ttggtcctca ttactgtgtc atatggccat gtggcagctg cagttcttcg tatccggtct       720
     gctgagggca ggaagaaagc cttctctacc tgcagctctc atctcactgt ggtaggcatc       780
     ttctatggga caggggtctt cagctacatg cgtctggggt cagtggaatc ttcagacaag       840
     gacaaaggca ttggcatcct caacactgtc atcagtccca tgctgaaccc acttatctac       900
     agccttagga accctgatgt gcagggtgcc ctacggaagg tgctcacagg gaggtagccc       960
     actaatgaca ctcttttctt ttggccttaa ccaatgtcag agc                        1003
//

If you have problems or comments...

PBIL Back to PBIL home page