(data stored in ACNUC10409 zone)

EMBL: BC120986

ID   BC120986; SV 1; linear; mRNA; STD; HUM; 1010 BP.
XX
AC   BC120986;
XX
DT   25-AUG-2006 (Rel. 88, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens transmembrane 6 superfamily member 2, mRNA (cDNA clone
DE   IMAGE:40116100), partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1010
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1010
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-AUG-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; c3980a578b749ee2e99422719132046c.
DR   Ensembl-Gn; ENSG00000213996; homo_sapiens.
DR   Ensembl-Tr; ENST00000389363; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 27 Row: c Column: 21.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genome
CC   (build 2).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1010
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_283"
FT                   /clone="IMAGE:40116100"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: TTTACATT sequenced from
FT                   the reverse primer"
FT                   /db_xref="taxon:9606"
FT   gene            1..>1010
FT                   /gene="TM6SF2"
FT   CDS_pept        25..>1010
FT                   /codon_start=1
FT                   /gene="TM6SF2"
FT                   /product="TM6SF2 protein"
FT                   /db_xref="GOA:Q9BZW4"
FT                   /db_xref="H-InvDB:HIT000388183.7"
FT                   /db_xref="HGNC:HGNC:11861"
FT                   /db_xref="InterPro:IPR033118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9BZW4"
FT                   /protein_id="AAI20987.1"
FT                   /translation="MDIPPLAGKIAALSLSALPVSYALNHVSALSHPLWVALMSALILG
FT                   LLFVAVYSLSHGEVSYDPLYAVFAVFAFTSVVDLIIALQEDSYVVGFMEFYTKEGEPYL
FT                   RTAHGVFICYWDGTVHYLLYLAMAGAICRRKRYRNFGLYWLGSFAMSILVFLTGNILGK
FT                   YSSEIRPAFFLTIPYLLVPCWAGMKVFSQPRALTRCTANMVQEEQRKGLLQRPADLALV
FT                   IYLILAGFFTLFRGLVVLDCPTDACFVYIYQYEPYLRDPVAYPKVQMLMYMFYVLPFCG
FT                   LAAYALTFPGCSWLPDWALVFAGGIGQAQFSHMGASMHLRTPFTYRVP"
FT   misc_difference 411
FT                   /gene="TM6SF2"
FT                   /note="'A' in cDNA is 'C' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the human
FT                   genomic sequence and not the cDNA."
XX
SQ   Sequence 1010 BP; 165 A; 326 C; 268 G; 251 T; 0 other;
     agccggggtc cagcagccgc cgctatggac atcccgccgc tggccggcaa gatcgcggcg        60
     ctgtcgctga gcgccctccc ggtgtcctac gcgctcaacc acgtctcggc gctctcgcac       120
     cccctgtggg tggcattgat gagcgcccta atcctgggtc tgcttttcgt ggcggtctac       180
     agcttgtccc atggcgaggt ctcctatgac ccactctatg ctgtcttcgc tgtcttcgcc       240
     ttcacctcgg ttgtggacct catcatcgct cttcaggaag acagctatgt ggtgggcttc       300
     atggagttct acaccaagga gggagagcca tacctgcgca cagcgcacgg agtcttcatc       360
     tgctactggg atggcactgt tcactacctc ctctacctgg ccatggccgg agccatctgc       420
     agaaggaaga gataccggaa ttttggactc tactggctgg gttccttcgc catgagcatc       480
     ctggtgttcc ttacaggaaa cattcttggc aaatacagct ccgagatcag gcctgccttc       540
     ttcctcacca tcccctacct gctggtgcca tgctgggctg gcatgaaggt cttcagccag       600
     ccccgggcgc taacccgctg caccgccaac atggtgcaag aggaacaaag aaagggactc       660
     ctgcagcgtc cggctgacct ggcccttgtc atatatctca tccttgctgg cttcttcact       720
     ctgttccggg gcctggtggt gcttgattgc cccacagatg cctgctttgt ctatatctac       780
     cagtatgagc catacctgcg ggaccctgtg gcctacccta aggtgcagat gctgatgtac       840
     atgttttatg tcctgccttt ctgcggcctg gctgcctatg ctctcacctt ccctggttgc       900
     tcctggcttc cagactgggc cttggtgttt gctggaggca tcggccaggc acagttctcg       960
     cacatggggg cttccatgca cctgcgcaca cccttcacct accgtgtgcc                 1010
//

If you have problems or comments...

PBIL Back to PBIL home page