(data stored in ACNUC15465 zone)

EMBL: BC121182

ID   BC121182; SV 1; linear; mRNA; STD; HUM; 441 BP.
XX
AC   BC121182;
XX
DT   08-AUG-2006 (Rel. 88, Created)
DT   19-MAR-2009 (Rel. 100, Last updated, Version 59)
XX
DE   Homo sapiens G antigen 12I, mRNA (cDNA clone MGC:150598 IMAGE:40123253),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-441
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-441
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-AUG-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; f1dfac7b503c38f6c443c729f109a02d.
DR   Ensembl-Gn; ENSG00000215269; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236362; homo_sapiens.
DR   Ensembl-Tr; ENST00000440137; homo_sapiens.
DR   Ensembl-Tr; ENST00000445148; homo_sapiens.
DR   Ensembl-Tr; ENST00000639028; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAM Plate: 29 Row: l Column: 21.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..441
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_283"
FT                   /clone="MGC:150598 IMAGE:40123253"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: ATAACTAT sequenced from
FT                   the forward primer"
FT                   /db_xref="taxon:9606"
FT   gene            1..441
FT                   /gene="GAGE12I"
FT                   /gene_synonym="AL4"
FT                   /gene_synonym="CT4.7"
FT   misc_difference 1..2
FT                   /gene="GAGE12I"
FT                   /gene_synonym="AL4"
FT                   /gene_synonym="CT4.7"
FT                   /note="2 bases at the 5' end do not align to the human
FT                   genome."
FT   misc_difference 7^8
FT                   /gene="GAGE12I"
FT                   /gene_synonym="AL4"
FT                   /gene_synonym="CT4.7"
FT                   /note="1 base in the human genome, T, is not found in
FT                   cDNA."
FT   CDS_pept        61..414
FT                   /codon_start=1
FT                   /gene="GAGE12I"
FT                   /gene_synonym="AL4"
FT                   /gene_synonym="CT4.7"
FT                   /product="G antigen 12I"
FT                   /db_xref="GOA:O76087"
FT                   /db_xref="H-InvDB:HIT000388379_06.4"
FT                   /db_xref="HGNC:HGNC:4104"
FT                   /db_xref="InterPro:IPR008625"
FT                   /db_xref="InterPro:IPR031320"
FT                   /db_xref="UniProtKB/Swiss-Prot:O76087"
FT                   /protein_id="AAI21183.1"
FT                   /translation="MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGE
FT                   PATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEE
FT                   VKTPEEGEKQSQC"
XX
SQ   Sequence 441 BP; 123 A; 96 C; 137 G; 85 T; 0 other;
     gtctgtgggt tcctgccgtc cggactcttt ttcctctact gagattcatc tgtgtgaaat        60
     atgagttggc gaggaagatc gacctattat tggcctagac caaggcgcta tgtacagcct       120
     cctgaaatga ttgggcctat gcggcccgag cagttcagtg atgaagtgga accagcaaca       180
     cctgaagaag gggaaccagc aactcaacgt caggatcctg cagctgctca ggagggagag       240
     gatgagggag catctgcagg tcaagggccg aagcctgaag ctcatagcca ggaacagggt       300
     cacccacaga ctgggtgtga gtgtgaagat ggtcctgatg ggcaggagat ggacccgcca       360
     aatccagagg aggtgaaaac gcctgaagaa ggtgaaaagc aatcacagtg ttaaaagaag       420
     gcacgttgaa atgatgcagg c                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page