(data stored in ACNUC31183 zone)

EMBL: BC123395

ID   BC123395; SV 1; linear; mRNA; STD; MAM; 3269 BP.
XX
AC   BC123395;
XX
DT   23-SEP-2006 (Rel. 89, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Bos taurus RAP1 GTPase activating protein, mRNA (cDNA clone MGC:139675
DE   IMAGE:8211866), complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-3269
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (20-SEP-2006) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; 84dc4dbc8f7ab7709b69859fc0b73a36.
DR   Ensembl-Gn; ENSBTAG00000008952; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000011785; bos_taurus.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: Lee Alexander, USDA, ARS, NPA
CC   cDNA Library Preparation: Express Genomics
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Tanaguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Chun E, Liao N, Beland J, Cruz K, Featherstone R, Kirk H,
CC   Matsuo C, Mayo M, Moore R, Munro S, Roger J, Tam B, Trinh E, Sze W,
CC   Wilton J, Wanger S, Huang P, Chu B, Imanian B, Roscoe R, Holt R,
CC   Jones S, Marra M
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 268 Row: c Column: 17.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3269
FT                   /organism="Bos taurus"
FT                   /lab_host="DH10B"
FT                   /strain="L1 Hereford"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-26"
FT                   /clone="MGC:139675 IMAGE:8211866"
FT                   /tissue_type="Thalamus, female calf 8.5 months, L1
FT                   Hereford"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:9913"
FT   gene            1..3269
FT                   /gene="RAP1GAP"
FT   CDS_pept        181..2172
FT                   /codon_start=1
FT                   /gene="RAP1GAP"
FT                   /product="RAP1 GTPase activating protein"
FT                   /db_xref="GOA:Q08E64"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR003109"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/TrEMBL:Q08E64"
FT                   /protein_id="AAI23396.1"
FT                   /translation="MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPL
FT                   ILLPQFGGYWIEGTNHEITSIPETEPLQSPTTKVKLECNHTARLYRKHFLGKEHFNYYS
FT                   LDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCED
FT                   VNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVE
FT                   FLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQ
FT                   LQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARD
FT                   DVPFFGPPLPDPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYE
FT                   ELHIHSQSMMGLGGDEDKMENGGGGGGFFESFKRVIRSRSQSMDAMGLSNKKPHTVSTS
FT                   HSGSFTPNNPDLAKAAGISLIVPGKSPTRKKSGPFGSRRSSAIGIENIQEVQEKRESPP
FT                   AGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRAETVAQRAEVLKDFSRSSSSASSFA
FT                   SVVEEAEGVDADDTGLESVSSSGTPHKRDSFIYSTWLEDSISTTSGGSSPGPSRSPHPD
FT                   AGKLGDPACPEIKIQLEASEQHTPQLGC"
XX
SQ   Sequence 3269 BP; 736 A; 1018 C; 952 G; 563 T; 0 other;
     cagagctgca gctgcagccg cgggcaccgg agcgccgagc ccaggacgcc cccggcccag        60
     gcccgcggga ggagtgatgg gcagaaccag cgcttccctc aggcactaga cctgccaaga       120
     gtggatttag ttccctctca gaccgcttca ttccaaccta agaacacaga tctgtttgag       180
     atgattgaaa agatgcaggg aagcaggatg gatgaacagc gatgctcctt cccaccaccc       240
     ctcaaaacgg aggaggacta cattccgtac ccgagtgtcc acgaggtcct gggccgagaa       300
     gggcccttcc ccctgatcct gctgccccag tttgggggct actggattga aggcaccaat       360
     cacgaaatca ccagcatccc agagacagag ccgctgcagt cgcccacgac caaggtgaag       420
     ctggagtgca accacactgc ccgcctctac cggaagcact ttctcggcaa ggagcacttt       480
     aactactact cgctggacac cgccctgggc caccttgtct tctcactcaa gtatgacgtc       540
     atcggggacc aggaacacct gcggctgctg ctcaggacca agtgccggac ataccacgac       600
     gtcatcccca tctcctgcct cactgagttc cccaacgtgg tccagatggc aaagttggtg       660
     tgtgaagacg tgaatgtgga tcgattctat cctgtgctgt accccaaggc ctctcgcctc       720
     attgtcacct tcgacgagca cgttatcagc aataacttca agttcggagt catttatcag       780
     aagctcgggc agacctccga ggaagaactc ttcagcacca acgaggagag ccctgccttc       840
     gtggagttcc tcgagtttct gggccagaag gtcaaattgc aggactttaa ggggttccga       900
     ggaggcctgg acgtgaccca cgggcagacg gggaccgagt ctgtgtactg caacttccgc       960
     aacaaggaga tcatgtttca cgtgtccacc aagctgccct acacagaagg agacgcccag      1020
     cagttgcagc ggaagcgaca cattggcaac gacatcgtgg ctgtggtctt ccaggacgag      1080
     aacacgccgt ttgtgccgga catgattgcg tccaacttcc tgcacgccta cgtagtggtg      1140
     caggccgagg gtgggggccc cgacggcccc ctctacaagg tgtccgtcac tgcgagagat      1200
     gacgtcccct tcttcgggcc acccctcccg gaccctgctg tgtttcggaa ggggcctgag      1260
     ttccaggaat ttttgctgac aaagctgatc aatgccgaat atgcttgcta caaggcagag      1320
     aagtttgcca agctggagga gcggacacgg gccgcccttc tggagacgct ctatgaggag      1380
     ctgcacatcc acagtcagtc catgatgggc ctgggcggcg acgaggacaa gatggaaaac      1440
     ggcggcgggg gtggcggctt ctttgagtcc ttcaagcggg tcatccggag ccgcagccag      1500
     tccatggatg ccatggggct gagcaacaag aagccccaca ccgtgtccac cagccacagc      1560
     gggagcttca cgcccaacaa ccccgacctg gccaaggcag ctggaatatc gctgattgtc      1620
     cctggcaaga gccccacgag gaagaagtcg ggtccgtttg gctctcgccg cagcagcgct      1680
     atcggcatcg agaacatcca ggaggtgcag gagaagaggg agagcccccc ggccggccag      1740
     aagaccccag acagcgggca cgtctcccag gagcccaagt cggagaactc atccactcag      1800
     agctccccag agatgcccac gaccaaaaac agagcggaga cagtggccca gagagcagaa      1860
     gtgctgaagg acttctcccg ctcctcgtcc agcgccagca gcttcgccag cgtcgtggag      1920
     gaagcagagg gcgtggatgc ggacgacaca ggcctggaga gtgtttcctc ctcgggcacg      1980
     ccccacaagc gggactcctt catctacagc acgtggctgg aagacagcat cagtaccacg      2040
     agcggaggca gctccccagg cccctctcgg tcaccccatc ccgacgccgg caagttgggg      2100
     gaccctgcat gtcccgagat caagatccag ctggaagcat ctgaacagca cacgccccag      2160
     ctgggctgtt agccacgctg tcactctgaa ggtgaccccg agcagacgag ggtgcggaag      2220
     cacgaggcga ggctgctccg gcagatccgg gcggacgggc cttctgccca gaggccagca      2280
     ccagcctggg ggccgcccct cgcctgccca gccctcctcc tggcccacgt ctgggctgtc      2340
     tctgcagggc agagccagcc agccctggga gcggggaagc tgctggcacc gtccccaccc      2400
     cctgggctgg ggggctggct ggggcaggga gaggtcagtt ggaacgggac tccaggcctg      2460
     gctcatccat cacccctggg tgcccctctg cattcgagag aatgagctgg aaaggagaac      2520
     tgaggcatct cagtgcacac agagcctgcc atggaggcac tgggtaggag gagccctggg      2580
     ctggggtcct gagtcctagc ttgtggttcg ggatccgctc tgcgactcta ggcccatcat      2640
     gctccctctc tgagtgcctc tgccctaaat ggatgaggtc atttcagagg tcgctgaaga      2700
     gtgggattct gtgcacctgc cccagagtgg aggatcctgg gggcctcccg tcaccctctc      2760
     ccgcttcttg gggttcctgg ggccccaggt cggctgaggg gcagggggct ggctgtgggc      2820
     cacggcacct cctagacctg ccaaggccct gcccaccgcc cctatgtgac agatgagtga      2880
     cccccttgtg ggcgtcgggg gacctacctg tctcttccgc catcccccgg ctcgaccccc      2940
     agcgtctcct gctcctggca ctccaggccg aggggtctca gctggctcac ctttgcacca      3000
     cccccacccc gcacggagcg ggcaggcagg cacagctgct gtgagtccac attctcgtgt      3060
     gtgtccacac tttttaggca ccacgccaag gggcagcctt ccggccccaa cacccatttc      3120
     ggaagccccc gtggccgcgt gtgtgtgtcg gtaacagttg tacaaaataa attctattta      3180
     tcgctattgt aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      3240
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaa                                        3269
//

If you have problems or comments...

PBIL Back to PBIL home page