(data stored in ACNUC4305 zone)

EMBL: BC123487

ID   BC123487; SV 1; linear; mRNA; STD; MAM; 1548 BP.
XX
AC   BC123487;
XX
DT   21-MAR-2007 (Rel. 91, Created)
DT   21-MAR-2007 (Rel. 91, Last updated, Version 1)
XX
DE   Bos taurus proteasome (prosome, macropain) 26S subunit, ATPase, 1, mRNA
DE   (cDNA clone MGC:139661 IMAGE:8281056), complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-1548
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (20-SEP-2006) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; 5d40de18f9cff07ed498a5f308d9131b.
DR   Ensembl-Gn; ENSBTAG00000005426; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000007135; bos_taurus.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: Lee Alexander, USDA, ARS, NPA
CC   cDNA Library Preparation: Express Genomics
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Taniguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Bala M, Barber S, Babakaiff R, Beland J, Chand S, Chun E,
CC   Del Rio L, Gibson S, Kirkpatrick R, Liu J, Matsuo C, Mayo M,
CC   Palmquist D, Santos RR, Stott J, Tsai M, Wong D, Wynhoven B, Hanson
CC   R, Siddiqui A, Holt R, Jones SJ, Marra MA
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 269 Row: b Column: 19.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1548
FT                   /organism="Bos taurus"
FT                   /lab_host="DH10B"
FT                   /strain="L1 Hereford"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-26"
FT                   /clone="MGC:139661 IMAGE:8281056"
FT                   /tissue_type="Thalamus, female calf 8.5 months, L1
FT                   Hereford"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:9913"
FT   gene            1..1548
FT                   /gene="PSMC1"
FT   CDS_pept        5..1327
FT                   /codon_start=1
FT                   /gene="PSMC1"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   ATPase, 1"
FT                   /db_xref="GOA:A4FUZ3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR035244"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A4FUZ3"
FT                   /protein_id="AAI23488.1"
FT                   /translation="MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDA
FT                   ASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRG
FT                   TPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVL
FT                   MDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGV
FT                   ILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSI
FT                   VFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPA
FT                   LIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAIC
FT                   TEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL"
XX
SQ   Sequence 1548 BP; 436 A; 384 C; 458 G; 270 T; 0 other;
     caagatgggt caaagtcaga gtggtggcca cggtcctgga ggcggcaaga aggacgataa        60
     ggacaagaaa aagaaatatg aacctcctgt accaactcga gttgggaaaa agaagaagaa       120
     gacaaaggga ccagatgctg ccagcaaact gcccctggtg acgcctcaca ctcagtgccg       180
     gttaaaactg ctgaagctag agagaattaa agactatctc ctcatggagg aggagttcat       240
     tagaaaccag gagcagatga agccgttaga agaaaagcaa gaggaggaga ggtcaaaggt       300
     ggatgacctc cgggggacgc cgatgtcagt agggaccctg gaggagatca tcgatgacaa       360
     ccatgccatc gtgtccacgt ctgtgggctc ggagcactac gtcagcatcc tctcgttcgt       420
     agacaaggac ctgctggagc ccggctgctc cgtgctgctc aaccacaagg tgcacgcggt       480
     gatcggggtg ctgatggacg acacggaccc cttggtcaca gtgatgaagg tggaaaaggc       540
     gccccaagag acctacgccg acatcggggg gctggacaac cagatccagg aaatcaagga       600
     gtccgtggag cttcctctca ctcatcctga atactacgaa gagatgggga tcaagccccc       660
     caagggggtc attctctatg gtccgcccgg cacagggaaa accttattag ccaaagcagt       720
     ggcgaaccag acctcagcca ccttcttgcg agtggtcggc tctgaactca ttcagaagta       780
     cctgggcgac ggccccaagc tcgttcggga actgtttcga gtcgctgaag aacacgcacc       840
     atccatcgtc tttattgatg aaattgatgc tattgggaca aaaaggtacg actccaactc       900
     aggcggggag agggagattc agcgaacgat gctggagctg ctgaaccagc tggacggctt       960
     tgactcaagg ggagacgtga aagtcatcat ggccacaaac cggatagaga cgctggaccc      1020
     ggccctcatc agaccaggcc gcatcgacag gaagatcgag ttccccctgc ccgacgaaaa      1080
     gaccaagaag cgcatcttcc agatccacac gagcaggatg acgctggccg atgacgtgac      1140
     cctggacgac ttgatcatgg ctaaagacga cctctctggt gccgacatca aggcaatctg      1200
     tacagaagct ggtctgatgg ccttgagaga gcgcagaatg aaagtaacaa atgaagactt      1260
     caaaaagtcg aaggaaaatg ttctttataa aaagcaggag ggcaccccag aggggctgta      1320
     tctctagtag gccagagctg ccttccagga gaggctggga gggccctggc tgctggaggg      1380
     gtgaggtggg aggctgcctg cctgggtgcc cgtgtgttca ctggccacgg ttggcagagc      1440
     gtttcgtgtc cctcccgagc gcagcgtgta ggggcctggc aggctgcctg cgtcccaata      1500
     aagcgtgctt tctctaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaa                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page