(data stored in ACNUC22857 zone)

EMBL: BC123583

ID   BC123583; SV 1; linear; mRNA; STD; MAM; 3374 BP.
XX
AC   BC123583;
XX
DT   23-SEP-2006 (Rel. 89, Created)
DT   24-JAN-2007 (Rel. 90, Last updated, Version 4)
XX
DE   Bos taurus adaptor-related protein complex 2, beta 1 subunit, mRNA (cDNA
DE   clone MGC:142344 IMAGE:8190069), complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-3374
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (20-SEP-2006) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; d5fd271597282df0cc65844c50d4ce59.
DR   Ensembl-Gn; ENSBTAG00000020316; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000076585; bos_taurus.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: Y. Meng, M. Taniguchi, S. Lobo, L. Guan and S.
CC   Moore
CC   cDNA Library Preparation: M. Masaaki, Y. Meng, S. Lobo,  L. Guan
CC   and Dr. S. Moore
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Taniguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Bala M, Barber S, Babakaiff R, Beland J, Chand S, Chun E,
CC   Del Rio L, Gibson S, Kirkpatrick R, Liu J, Matsuo C, Mayo M,
CC   Palmquist D, Santos RR, Stott J, Tsai M, Wong D, Wynhoven B, Hanson
CC   R, Siddiqui A, Holt R, Jones SJ, Marra MA
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 272 Row: e Column: 14.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3374
FT                   /organism="Bos taurus"
FT                   /lab_host="DH10B"
FT                   /strain="Hereford"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-13"
FT                   /clone="MGC:142344 IMAGE:8190069"
FT                   /tissue_type="Thymus, female, 8.5 months, Hereford"
FT                   /note="Vector: pCMV-SPORT6.0"
FT                   /db_xref="taxon:9913"
FT   gene            1..3374
FT                   /gene="AP2B1"
FT                   /note="synonym: CLAPB1"
FT   CDS_pept        121..2976
FT                   /codon_start=1
FT                   /gene="AP2B1"
FT                   /product="adaptor-related protein complex 2, beta 1
FT                   subunit"
FT                   /db_xref="GOA:Q08DS7"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08DS7"
FT                   /protein_id="AAI23584.1"
FT                   /translation="MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGK
FT                   DVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLD
FT                   SLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFI
FT                   LDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKESDYYNMLL
FT                   KKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHK
FT                   PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLD
FT                   LGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPS
FT                   PTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYME
FT                   MNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKME
FT                   PLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKEC
FT                   HLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSL
FT                   KCRAPEVSQYIYQVYDSILKN"
XX
SQ   Sequence 3374 BP; 928 A; 805 C; 807 G; 834 T; 0 other;
     gagacctgga gaaggagtcg tgacgtgcgg gaaaccatta caacatcgct cgggccgtgc        60
     tctctggccg ctgctgccac ccccgccctt gcctacggtg cacattaaag atccaaaacc       120
     atgactgact ctaagtactt cacaaccaat aaaaaaggag aaatctttga attaaaggct       180
     gaactcaaca atgaaaagaa agaaaagagg aaggaggctg tgaagaaagt gattgctgct       240
     atgactgtgg ggaaagacgt tagctctctc tttccagatg tagtgaactg tatgcagacg       300
     gataatctgg aactgaagaa gcttgtgtat ctctacttga tgaactatgc caagagtcag       360
     ccagacatgg ccatcatggc tgtcaacagc tttgtgaagg attgtgaaga tcccaatcct       420
     ctgattcgag ctttggcagt cagaaccatg gggtgcatcc gggtggacaa gataacagag       480
     tatctctgtg agcccctccg caagtgctta aaggatgaag atccctacgt ccggaagaca       540
     gcagcagtct gcgtggcaaa actccatgac atcaatgccc agatggtgga agatcaggga       600
     tttctggatt ctctgcggga tctcatagca gattcaaatc caatggtggt ggctaatgct       660
     gtagcagcac tatctgaaat cagtgaatct caccccaaca gcaacttact cgatctgaat       720
     ccacagaaca ttaataagct actgacagcc ctgaatgagt gcaccgaatg gggccagatt       780
     ttcatcctgg actgcttatc taattacaat cctaaagatg accgggaggc tcagagcatc       840
     tgtgagcggg taactccccg gttatctcat gccaactcag cagtggtgct ttcagcagta       900
     aaagtcctaa tgaaattttt agagttgcta cccaaggagt ctgactacta caatatgctg       960
     ctgaagaagt tggcccctcc acttgtcact ttgctgtctg gggagccaga ggtgcagtac      1020
     gtcgccctga ggaacatcaa cctaattgtt cagaaaaggc ctgaaatctt gaagcaggaa      1080
     ataaaagttt tctttgtgaa gtacaatgat cccatctatg tgaaactaga gaagttggac      1140
     atcatgattc gtttggcatc ccaagccaac attgctcagg ttctggctga actgaaagag      1200
     tatgccacag aggtggatgt tgactttgtg cgcaaagctg tgcgagccat tgggcggtgt      1260
     gccatcaagg tggagcaatc tgcagagcgc tgtgtgagca cgttgcttga tctcatccaa      1320
     accaaagtaa attatgtggt ccaagaggcg attgttgtca tcagggacat tttccgcaaa      1380
     tatcccaaca aatacgaaag tatcattgcc acactgtgtg agaacttaga ttctctggat      1440
     gagccagacg ctcgagcagc tatgatttgg attgtgggag aatatgctga aagaattgac      1500
     aatgccgatg agttactaga gagcttcctg gagggttttc atgatgaaag cacgcaagtg      1560
     cagctcactc tgctcactgc catagtgaag ctgtttctca agaaaccgtc agaaacacag      1620
     gagctggtac agcaggtctt gagtttggca acacaggatt ctgataatcc tgaccttcga      1680
     gaccggggct atatttattg gcgccttctc tcaactgatc ctgtcacagc taaagaagta      1740
     gtcttgtctg aaaagccact gatttctgag gagacagatc ttattgagcc aactctactg      1800
     gatgagctaa tctgccacat tggttctttg gcctcagtgt accataagcc gcccaatgct      1860
     tttgtggaag gaagtcatgg aatccatcgc aaacacttgc caatacatca tgggagcact      1920
     gatgcaggag acagccctgt gggcacaacc actgccacca acctggagca gcctcaggtt      1980
     attccctccc agggtgacct tctgggggat cttttaaacc ttgaccttgg tcccccagtc      2040
     aatgtgccac aggtatcttc catgcagatg ggagcagtgg atctcttggg aggaggccta      2100
     gatagtctgc ttggcagtga ccttggcggg ggcattggag gaagtccggc agtgggacag      2160
     tccttcatcc catcatcagt gcctgcaacc tttgctccct cccctactcc tgctgtggtc      2220
     agcagtggtc tgaatgacct gtttgaactc tccacgggga taggcatggc acctggtgga      2280
     tatgtggctc ctaaggctgt ctggctgcct gcagtaaagg ctaaaggcct ggagatttca      2340
     ggaacattta ctcaccgcca agggcatatc tatatggaaa tgaacttcac caacaaagct      2400
     ctacagcaca tgacagactt cgcaattcag tttaacaaga atagctttgg tgtcatccct      2460
     agcactcctc tggccatcca tacaccactg atgccaaacc agagcattga tgtctccctg      2520
     cccctcaaca ccttgggccc tgtcatgaag atggagcctc tgaacaacct gcaggtggct      2580
     gtgaaaaaca atattgatgt cttctacttc agctgcctca tcccactcaa cgtgcttttt      2640
     gtagaagatg gcaaaatgga gcgccaggtc ttccttgcaa catggaagga tattcccaat      2700
     gaaaatgagc ttcagtttca gattaaggaa tgtcatttaa atgctgacac tgtttccagc      2760
     aagttgcaaa acaacaatgt ttatactatt gccaagagga atgtggaagg gcaggacatg      2820
     ctgtaccaat ccctgaagct cactaacggc atttggattt tggccgagct acgtatccaa      2880
     ccaggaaacc ccaattacac gctgtcactg aagtgtagag ctcccgaggt ctcccagtac      2940
     atctatcagg tctacgacag cattttgaaa aactaataga ctggtccggt gccctccagc      3000
     caccctgtga tcggtgcagg ccaagaactc ttgaactgga agaaattgtt atcgccatgt      3060
     agaatctgaa cctgaacaca ccgaggctac ccgccaaggt agtgactagt ctaacctgtg      3120
     ctaatgttag ggcaccgcct gttggatagt ttagcttcct gtgaccgtct gtaaccactg      3180
     cttcagtcac ttcccacctc gtgccacccg ctgctctctg tcctcacttg tgggcttctc      3240
     catgctgtcc ttagagtggc tgcagttttg agtgtagttt gatattttgt aatcgagacc      3300
     tcgtttcaaa agcagaaaaa gacaacaaaa aatattaaag caaggaaaag tgtcactgaa      3360
     aaaaaaaaaa aaaa                                                        3374
//

If you have problems or comments...

PBIL Back to PBIL home page