(data stored in ACNUC11314 zone)

EMBL: BC123670

ID   BC123670; SV 1; linear; mRNA; STD; MAM; 2437 BP.
XX
AC   BC123670;
XX
DT   21-MAR-2007 (Rel. 91, Created)
DT   27-JUN-2007 (Rel. 92, Last updated, Version 2)
XX
DE   Bos taurus hypothetical LOC538515, mRNA (cDNA clone MGC:143103
DE   IMAGE:8230221), complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-2437
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (20-SEP-2006) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; b09b76bc588aca2248da411dd7775a03.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: Lee Alexander, USDA, ARS, NPA
CC   cDNA Library Preparation: Express Genomics
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Tanaguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Chun E, Liao N, Beland J, Cruz K, Featherstone R, Kirk H,
CC   Matsuo C, Mayo M, Moore R, Munro S, Roger J, Tam B, Trinh E, Sze W,
CC   Wilton J, Wanger S, Huang P, Chu B, Imanian B, Roscoe R, Holt R,
CC   Jones S, Marra M
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 270 Row: o Column: 13.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2437
FT                   /organism="Bos taurus"
FT                   /lab_host="DH10B"
FT                   /strain="L1 Hereford"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-28"
FT                   /clone="MGC:143103 IMAGE:8230221"
FT                   /tissue_type="Cerebral cortex , female calf 8.5 months, L1
FT                   Hereford"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:9913"
FT   gene            1..2437
FT                   /gene="MGC143103"
FT   CDS_pept        16..450
FT                   /codon_start=1
FT                   /gene="MGC143103"
FT                   /product="MGC143103 protein"
FT                   /db_xref="InterPro:IPR009533"
FT                   /db_xref="UniProtKB/TrEMBL:A4FV31"
FT                   /protein_id="AAI23671.1"
FT                   /translation="MYSEIQRERADIGGLMARPEHREWNPELIKPKKLLNPVKASRNHQ
FT                   EMHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQ
FT                   QRLNQLEKPPEKEEDHAPEFIKVRENLRRITTLTSGERAL"
XX
SQ   Sequence 2437 BP; 575 A; 743 C; 656 G; 463 T; 0 other;
     ctccggtccg cctccatgta ctcggagatc cagagggagc gggccgacat cggaggcctg        60
     atggcccggc cagaacacag agaatggaac ccagagctca tcaagcccaa gaagctgctg       120
     aaccccgtga aggcctcccg gaaccaccag gagatgcacc gcgagctgct catgaaccac       180
     aggaggggcc tgggcgtgga cagcaagccc gagctgcagc gtgtcctgga gcaccgccgg       240
     cggaaccagc tcatcaagaa gaagaaggag gagctggagg ccaagcggct gcagtgcccc       300
     tttgagcagg agctgctgag acggcagcag aggctgaacc agctggagaa accaccagaa       360
     aaggaagagg accacgcccc tgaattcatt aaagtcaggg aaaacctgcg gagaatcacc       420
     actttgacca gtggagagag ggcgctgtag agctggctcc ggagctccag cgccccggca       480
     gcccaccctg gcccctatgc cctccagccc cactgtacct ggcagccctg acccccagac       540
     tcggctctgc ggtgttcatg cttgctcctg gaaaaacgca tctccccaga gggcagcccc       600
     ccacctgacc cccagaagat gggggatcct gaatgcaggc ttttccttct agcgctcatc       660
     gctcctgctc ccagaagcag ccgctgctga gggaactttc cccaggctcc ctccttgagg       720
     ggctgctgag ccctgccaag atgcttcagg cagagctgag aagggacagg tgcccctctg       780
     gctggacgag ccgtccattc tgcccaggcc ccatggggcc ctgcttctct ggacagccca       840
     ggtctcagag agctgcccta ctgtggtctc tgcagccagg tgtggggcag ctaagcagag       900
     catcttgggg gcacctaccc tgaaagcctg aggggagaat ggcctgtcct caggacgggt       960
     ggggcagccc aaggccctcc aaggttgacg cacactaaca aagacagctg cggatggtct      1020
     gccagcctct ccccaccgct tcaccttcat tccctccacg cttttctccc ccgtccagac      1080
     cctgtaccca cagcagccca gggctgcagc tgctccgctt ctggaagtta gaacagcgct      1140
     gtgtgaactt tactgtgcct gtgcattacc agggccctct gctggaagac ggcttctgat      1200
     cccgcaggct ggggtgagag ctgagaatct tgtttctaac aagctcctgg accgccgcgc      1260
     tgaggctcac actgtccctg gcaaggctgg agcatccagg ggtggcgaat aaaagccctc      1320
     ccagctcccg ggacccccat cctggagatt cccatccgcc tccacagccc caaggcgctc      1380
     tttattttcc tccaccccag gggccccggg ccggggaaca cccctagcta ggaaacggtg      1440
     ttggttatgt gaccagagat gcatgcaatt ctagccaaaa aattcacaaa acttttttaa      1500
     aaagaacctg tccccaaagc ctacaaaaag caaatacata gtgattttca acaggctttg      1560
     gaaaacataa gaaactagtc tgaggcccca gccccaccct gacacactgg ccctgctgag      1620
     tgcgcttgag gcccacgccc gactcgatct gtcaccgggg ccaactccgt gggttcactc      1680
     acccattcct tctgagaact cgcctcccag cacggaccaa atgtttgcac tttcgctcct      1740
     gtcccatatt taaagatctg gagacccatc aggccttttc cttttcccct gaagaataaa      1800
     acccctgccc ccatagctca ggcggtaaag aatccgcctg caatgtggga gacctgggtt      1860
     caattcctgg gtcgggaagc tcccctggag aaggaaatgg caacccactc cagtgttctt      1920
     gcctggagaa tcccatggtc acaggagcct ggtgggctac agttcatggg atcgcaagag      1980
     tcggacacga cttagtgcta tctttctttc tttctctggc tttgtaaacc catcgttcaa      2040
     ggtaacaggg cactagtcaa aaagcatttc cttttacccc ccaccccacc caccaagact      2100
     gctggacaga gctgctgctg ggatgcagtc tggtacctgg actgaagatg ggagggaagg      2160
     gacaccgccc tggtgttact cctacctggg tggctggagg gtgaccagag acatcatcct      2220
     tctcctgtgt gagctgaggg gcatgaatgt agacgtgctg cgtgtgggga gggagggagg      2280
     cgctaaaagg ctcttgaatg tgaccatttt ggtgagaagg agggaatgct gtttttacat      2340
     gtctgtccgg caagagtcat gctaaaaatg cacaacccct gagtaaagac caccacttcc      2400
     ccaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa                               2437
//

If you have problems or comments...

PBIL Back to PBIL home page