(data stored in ACNUC15260 zone)

EMBL: BC125300

ID   BC125300; SV 1; linear; mRNA; STD; MUS; 1036 BP.
XX
AC   BC125300;
XX
DT   03-NOV-2006 (Rel. 89, Created)
DT   17-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Mus musculus olfactory receptor 45, mRNA (cDNA clone MGC:159003
DE   IMAGE:40129815), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1036
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1036
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; da158e5aaa379bdf0e1c0e8d0a68f76e.
DR   Ensembl-Gn; ENSMUSG00000066122; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033187; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033169; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033101; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033170; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032884; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033681; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032214; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032856; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033009; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032961; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033103; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032994; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033701; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032325; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000084454; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214637; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087412; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087498; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087434; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087453; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087016; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0087957; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087543; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0086959; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087154; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0086999; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087185; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087036; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088255; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086054; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 4 Row: A Column: 24.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1036
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_389"
FT                   /clone="MGC:159003 IMAGE:40129815"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: TTAGTGTT"
FT                   /db_xref="taxon:10090"
FT   gene            1..1036
FT                   /gene="Olfr45"
FT                   /note="synonyms: MOR253-2, IB6"
FT   misc_feature    1..1036
FT                   /gene="Olfr45"
FT                   /note="This cDNA sequence aligns to the mouse C57BL/6J
FT                   genome (build 36) without differences"
FT   CDS_pept        24..959
FT                   /codon_start=1
FT                   /gene="Olfr45"
FT                   /product="olfactory receptor 45"
FT                   /db_xref="GOA:Q8VGM1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333826"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGM1"
FT                   /protein_id="AAI25301.1"
FT                   /translation="MMLRLNQTEVTEFVLEGFSEHPDLRLFLIGCFLTLYIMALMGNIL
FT                   IIALVTSSTGLHNPMYFFLCNLATTDILCTSSVIPKALVGLVSEENTISFKECMSQLFF
FT                   LAWSASSELLLLTVMAYDRYVAICCPLHYSSRMSPQMCGALAMGVWSISAVNASVHTGL
FT                   MTRLSFCGPKVITHFFCEIPPLLLLSCSPTYVNTIMTLLGDSFFGGVNFVLTLLSYGCI
FT                   IASILRMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVTSVLYSI
FT                   VSPTLNPLIYTLRNKDVKLALGRILASFSH"
XX
SQ   Sequence 1036 BP; 206 A; 285 C; 231 G; 314 T; 0 other;
     cagtggaccc catcctctcc ttgatgatgt tgagactcaa ccagacagaa gtaacagagt        60
     ttgtgctgga agggttctca gagcaccctg atctaagatt gttcctgata ggctgcttct       120
     tgaccctcta cataatggct ctgatgggca acattttgat catcgctttg gttacctcca       180
     gcactgggct ccacaatccc atgtactttt tcctgtgcaa cctggctacc acggatattt       240
     tgtgcacctc ctctgtgatt cctaaggcct tggttggcct agtgtctgag gaaaacacta       300
     tctccttcaa ggaatgtatg tctcagctct tcttccttgc atggtcagca tcttctgagc       360
     tgctgctgct cacggtcatg gcctatgacc gctatgtggc catctgctgt cccctgcact       420
     acagctctag gatgagccca cagatgtgtg gggccctggc catgggtgta tggtccatca       480
     gtgctgtgaa tgcatctgtg cacactggcc tgatgacacg gctgtcattc tgtggaccca       540
     aggtcatcac ccacttcttc tgtgagattc ccccactcct cctgctctcc tgtagtccta       600
     catatgtaaa taccattatg actcttttgg gagattcctt ttttggaggc gtcaattttg       660
     tgcttacctt gctatcctat ggctgcatca ttgccagcat cctgcgcatg cgttctgctg       720
     agggcaagag gaaggccttt tctacctgct catcccacct cattgtggtc tctgtgtact       780
     actcatctgt gttctgtgcc tatgtcagcc ctgcttccag ctacagtcca gaaagaagca       840
     aagttacctc agtgttatac tcgatcgtca gcccaaccct caaccccctc atctatacac       900
     tgaggaacaa ggatgtcaag cttgccttgg gcagaatatt ggcctctttc tcacattaag       960
     tggagatgtg caggcttttc ttctggcctg tgctgttcct aatcacactt ttctaagagc      1020
     agattcgtgg ggtgtg                                                      1036
//

If you have problems or comments...

PBIL Back to PBIL home page