(data stored in ACNUC10083 zone)

EMBL: BC125873

ID   BC125873; SV 1; linear; mRNA; STD; VRT; 3982 BP.
XX
AC   BC125873;
XX
DT   03-NOV-2006 (Rel. 89, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Danio rerio chloride channel 7, mRNA (cDNA clone MGC:153490 IMAGE:5605252),
DE   complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-3982
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3982
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-OCT-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 2a3e1041f6e4ffe437edac9bb7e93894.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Sumio Sugano
CC   cDNA Library Preparation: Dr. Sumio Sugano
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 283 Row: h Column: 23
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi:
CC   116487944.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3982
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Sugano SJD adult male"
FT                   /clone="MGC:153490 IMAGE:5605252"
FT                   /tissue_type="Whole body, adult male"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..3982
FT                   /gene="clcn7"
FT                   /note="synonyms: im:7155923, zgc:153490"
FT   CDS_pept        88..2475
FT                   /codon_start=1
FT                   /gene="clcn7"
FT                   /product="chloride channel 7"
FT                   /db_xref="GOA:A0JMG8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002249"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A0JMG8"
FT                   /db_xref="ZFIN:ZDB-GENE-061103-196"
FT                   /protein_id="AAI25874.1"
FT                   /translation="MANITKKVSWSSRGDDRGERTPLLNGAEDSKLNRQLSGGGIFHIG
FT                   RLSTVDLEEEITPEEDIIRSRPKEIPHNEKLLSLKYESLDYDNSENQLFLEEERRMSQM
FT                   GFRCLEITRWVICGLIGLLTGLIACLIDIAVENLAGLKYFAVKQNIEKFTELGGLSLSL
FT                   ILWAVLNSAFVMVGAIIVAFFEPIAAGSGIPQIKCYLNGVKVPRVVRLKTLVVKVFGVI
FT                   CSVAGGLAVGKEGPMIHSGAVVAAGVSQGRSTSLKKDFKMFEYFRRDTEKRDFVSAGAA
FT                   AGVSAAFGAPVGGVLFSLEEGASFWNQLLTWRIFFASMVSSFTLNFFLSIYHQKPGELS
FT                   SPGLINFGRFDSDSVQYNLYEIPLFIIMGALGGMLGALFNLLNYWLTIFRIRYIHRPCL
FT                   QVMEAMLVAAVTATVSFAMIYFSTECQPLGPDHTEEYPLQLFCADGEYNAMATAFFNTP
FT                   ERSVRSLFHNPPGTYNPMTLGVFTLAYFLLAVWTYGLTVSAGVFIPSLLIGAAWGRLFG
FT                   ILLSFITTSKSIWADPGKYALIGAAAQLGGIVRMTLSLTVILVEATGNVTYGFPIMLVL
FT                   MTAKIVGDYFVEGLYDIHIKLQSVPFLHWEAPPTSHWLTAREVMSSQVTCFNRIEKVGT
FT                   IVDVLSNTSTNHNGFPVVTHVTEIDEPSKLCGLVLRSQLIVLLKHKVFVERAFSRFSQR
FT                   KLQLKDFRDAYPRFPPIQSIHVSQDERECMMDLTEFMNPTPYTVPQETSLPRVFKLFRA
FT                   LGLRHLVVVDNENRVVGLVTRKDLARYHLGKDGLEELQLAQT"
XX
SQ   Sequence 3982 BP; 1058 A; 809 C; 913 G; 1202 T; 0 other;
     gcttatgatt gttagtcatg gggaagaact gtacgcagta gttctctgct tagcaggttt        60
     gatgtatctt tatttacgaa agtaaatatg gccaacatca cgaagaaagt gtcctggtcg       120
     agccgaggcg atgaccgcgg agagagaaca ccgctgctga acggagccga ggatagcaaa       180
     ctcaacagac agttatccgg gggaggtata tttcatatag gcaggctgag cactgtggac       240
     cttgaggagg aaatcacacc agaagaggac attataagaa gtcgaccgaa ggaaatccct       300
     cacaacgaaa agctgctgtc tctgaaatat gagagtcttg actatgataa cagtgagaat       360
     cagttgtttc tggaggagga gagacggatg agtcaaatgg gcttcagatg cctggagatc       420
     acacgatggg tgatctgcgg tttgattggt ttactcaccg gtctcatcgc atgcttgata       480
     gacattgctg tggagaacct tgcaggactt aagtactttg cagtcaaaca gaacattgag       540
     aaattcacag agctcggtgg cctgtccctc tctctcatac tgtgggcagt gctgaactct       600
     gctttcgtga tggttggtgc aatcattgtt gctttttttg agcccattgc tgcaggaagt       660
     ggaatccctc aaataaaatg ctatctgaat ggagtaaagg ttcctcgtgt tgttcggcta       720
     aagactctgg tggtaaaggt ctttggagtg atctgctcag tggctggagg tcttgctgtt       780
     ggaaaggaag ggcctatgat tcactcagga gcagtggtgg ctgcgggagt ttctcaaggc       840
     aggagcacgt cactgaaaaa agattttaag atgttcgagt atttccgcag ggacacagag       900
     aagagagact ttgtgtcggc aggagcagca gctggagtct ctgctgcctt tggggctcct       960
     gttggtggag ttttgttcag tttagaggaa ggagcatctt tctggaacca gttgttgaca      1020
     tggagaattt ttttcgcttc aatggtctct tccttcactc tgaacttttt cctgagcatt      1080
     taccatcaga agcctggaga actgtccagt cctggtctca ttaactttgg ccgctttgac      1140
     agtgatagtg tgcagtataa tttatatgaa attcctctct tcatcatcat gggagcttta      1200
     ggaggaatgc ttggagcatt gttcaatctc ctcaattatt ggctaacgat tttcagaata      1260
     aggtacatcc accgaccatg cctgcaggtg atggaggcga tgctggttgc tgctgtcact      1320
     gctacggttt cctttgctat gatctatttc tccaccgaat gccagccttt gggaccggac      1380
     cacactgaag aatatcctct acagctcttc tgcgctgatg gtgaatataa cgccatggcc      1440
     acggctttct tcaacacacc cgagcggagc gtcaggagcc tcttccacaa ccctccagga      1500
     acgtacaacc caatgacttt gggtgtcttt accctggcgt atttcctcct ggcggtctgg      1560
     acgtatggtt tgaccgtgtc cgcaggagtc ttcatcccat ctctgcttat cggtgcagcc      1620
     tggggtcgac tctttgggat acttttgtca ttcatcacta ccagtaaatc aatttgggca      1680
     gaccctggga aatatgcttt gatcggggct gcagcccaac ttggtggcat tgtccgaatg      1740
     accctcagtc tcacagttat tctggtagaa gccactggga atgtgaccta tggctttccc      1800
     atcatgcttg tgctaatgac tgccaagatt gttggggatt attttgtaga gggcctgtat      1860
     gacatccata ttaagctgca gagtgttcct ttcctccact gggaggctcc tcctacgtct      1920
     cattggctga cggccagaga ggtcatgagt tctcaagtca cctgcttcaa cagaatagag      1980
     aaggtcggaa ccattgtaga tgtcctcagc aacacttcca ccaatcacaa tggcttccca      2040
     gtggtcaccc atgttactga gattgacgag ccaagcaaac tctgtgggct tgttctccgc      2100
     tctcagctca ttgtccttct caaacataag gtgtttgtgg agagagcatt ttcacgtttc      2160
     agccaaagga agctacagct gaaggacttc agagacgcgt atccacgttt ccctcctatt      2220
     cagtccatcc acgtctctca ggatgagagg gagtgcatga tggacctgac cgagttcatg      2280
     aacccaacgc catacactgt tcctcaggag acttcactcc cccgtgtgtt taaattgttt      2340
     cgggctctag gactccgaca tctggtggtg gttgataatg agaacagggt tgtgggtcta      2400
     gtaaccagga aggaccttgc acgataccac ctgggtaaag acggcctgga ggagcttcag      2460
     ctggcacaga catgatcagt cttcatgttc accttcacca gccttcagag caccagcttt      2520
     acaccgtaag aactcagggc tggttagagt caaagatgcc aaacacaaac ctgcaacatg      2580
     cacaagtgtt ccaacattca gtattttaag ggctcgatta tttaaaaaaa acacacacac      2640
     acacatttat cacaatctaa gtctttatgc attcattttt gcttgtagaa atacagcaga      2700
     gtgagcacat tatgctagta tgagatgtta gttttgcact atgtgactgt ttatttatta      2760
     catttcagat attttagtgt cgattatctt tttgggagcc ctctgttttc atgcctatcc      2820
     aaaaagcatt atgtctttgg tttattacat ggctagcaag gctagttacc actagttttc      2880
     atgcctattg caaagtatat tgacataaaa atgtgtcggt atgcattgca ttttccacat      2940
     tgtttggtat ttttttgtgt ttacaacatt tcctgcacaa ttttaatgat cgacacttgt      3000
     gttgaattgt ggtgtttaaa aatattcatc atcagtgtgc agtttgctga tatggaatac      3060
     aatgcaatct acattcgtag cgtcaaagca tgggtttcgg gcttagtttc tggagtgacg      3120
     cagctctgca gttttgctcc aatccttata aaacacaatc aaggtgttcg agactctttt      3180
     aaacaacttg atcattttga ttagctgtgt ttgattgggg ttggagcaaa accttgcgga      3240
     gctgtggccc tccaggaatt gagtttgaga tccatgcatt aaagggacaa ttcaccccca      3300
     aaaattcaaa gaaaaaaaaa atggatgcac tgtcccttta agaagcctat tggtgatacc      3360
     tttatgtgca cttaaaacag actactacat attatattgt tacaaacatg caaaaatggt      3420
     tcgttttttt gtttatctag tgttgtttag gattttttaa atgtttgtgt ctagatttat      3480
     caatttaatt gctatcaaaa ataattgagg gtagatcagg ccctaaaacg aaaggcatca      3540
     attctatttg tctcatgctt cttggcattt gcaaggtttt tggtacgagt ttagaaaaaa      3600
     gccagcggtt ttatgtagag tttgtctcta cagaatgtga atttttgcca tgagctgcat      3660
     ttgttttctg tgaaaatctg tactttaaaa tgaaaaaaaa atcacagtat taaaaaaatg      3720
     aagtatgatt atgcttaaac gattgccaag cactgatcaa atgaaacatc tttaaatgaa      3780
     gcgtgtaaac attgtccggt ttagtctgct aagaagtctt gtataaagcc aatttgttgt      3840
     ttttattgat caatggtctt tctctctgct gatctctgct ttttatatgg ctgctgattt      3900
     gaagttaaaa aatgatttta taacaattta aacaagtttg tgaactaata aagctatgaa      3960
     tgaataaaaa aaaaaaaaaa aa                                               3982
//

If you have problems or comments...

PBIL Back to PBIL home page