(data stored in ACNUC16324 zone)

EMBL: BC125952

ID   BC125952; SV 1; linear; mRNA; STD; VRT; 2580 BP.
XX
AC   BC125952;
XX
DT   06-NOV-2006 (Rel. 89, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Danio rerio zgc:154079, mRNA (cDNA clone MGC:154079 IMAGE:8341762),
DE   complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-2580
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2580
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-OCT-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 77a0ef46de37a3ef6b9388b5b0e8e7a7.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Cassandra Belair
CC   cDNA Library Preparation: Open Biosystems
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 286 Row: n Column: 19
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis, Similarity but not identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2580
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_26"
FT                   /clone="MGC:154079 IMAGE:8341762"
FT                   /tissue_type="Ovary, 1 year old female, WIK strain"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:7955"
FT   gene            1..2580
FT                   /gene="zgc:154079"
FT   CDS_pept        27..2285
FT                   /codon_start=1
FT                   /gene="zgc:154079"
FT                   /product="zgc:154079"
FT                   /db_xref="GOA:A0JMP1"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029734"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A0JMP1"
FT                   /db_xref="ZFIN:ZDB-GENE-061110-100"
FT                   /protein_id="AAI25953.1"
FT                   /translation="MSTYKRATLEEEELLDTGSDGIYHTSSMQVGVQRGLGLRCWAEKN
FT                   HSERKLVVLVCALSVALFICIVSLGLHYKESHPGLCLSEPCVSVASAVLGSLDRSVDPC
FT                   QDFYNFACGGWMRKNPLPEGKSRWGPFSNLWEHNMAVMKNLLENTSMKSLSRAEQKAQW
FT                   YYQACMNESKIEELGAKPLQDLINQTGGWGLKGPWEKDNFQEVLRIVSANFRTSPFFTV
FT                   FVSTDSKSSNSNIIQVDQSGLGLPSREYYLNKTANEKYLNAYLNFLVELGVLLGGSQDT
FT                   SQKMMEEIIEFETTLANITVPQVERRDEEKIYYKIQAKELATLAPAIDWMPFLSSVFAP
FT                   VELNNSEPVVVYAKEYLQKVSELISNTNKSVLNNYMIMKVVRKMVSILDQKFQDAEQRF
FT                   LEVMYGTKKSCMPRWKLCVSDTDSALGFALGALFVKATFSEDSKAFVEDMVSEIKWAFE
FT                   DSLKTVSWMDPETKKAAKEKADAIYNMVGYPKFIMNPKELDKVFNDFDVVSDLYFQNVM
FT                   NYYNFSARVTADQLRKAPNRDQWSMTPPTVNAYYNPTKNEMVLPAGIFQAPFYNHAWPK
FT                   AMNFGGIGVVMGHELTHAFDDQGRKYDKDGNLAKWWQNSSVEAFQHQTQCMVEQYSNYS
FT                   INNEPLNGKHTLGENIADNGGLNAAYKAYVNWIKKNGEEASLPALGMNNHQLFFVGFAQ
FT                   VWCSVRTPESSHEGVITDPHSPSRFRVIGTISNSHEFSEHFGCKADSPMNPKRKCELW"
XX
SQ   Sequence 2580 BP; 736 A; 583 C; 624 G; 637 T; 0 other;
     agaagtttga agtacatttc cctcagatgt ctacttataa acgggccacg ctggaggaag        60
     aggagctgtt ggacaccggt tctgatggga tctaccacac ctctagcatg caggttggtg       120
     tacagcgtgg tctgggtctc agatgctggg cagaaaaaaa ccactccgag agaaaacttg       180
     tggtccttgt gtgcgctctt tctgtggctc tgttcatctg catcgtgtct ttgggtctgc       240
     actataaaga atctcatcca ggtctgtgcc tgtcggagcc atgtgtgagt gtagccagtg       300
     cagttctggg gtctctcgac cggtcggtgg acccctgcca ggacttttat aacttcgcat       360
     gtggaggctg gatgaggaaa aaccccctgc ctgagggcaa gtcccgctgg gggcctttca       420
     gcaacctgtg ggaacataac atggctgtca tgaagaactt gctagagaac accagcatga       480
     aaagcttgag cagagcagag cagaaagccc agtggtatta ccaagcctgc atgaacgaga       540
     gcaaaattga agagcttgga gcaaaaccac tccaggacct catcaatcag acgggaggct       600
     ggggcttgaa aggcccgtgg gagaaggata acttccagga ggttttacgg attgtgtcag       660
     ccaacttccg aacctctccc tttttcactg tttttgtcag cacagactcg aaaagctcca       720
     acagcaacat catacaggtg gatcagtcag gattgggact cccctctagg gaatactatc       780
     tcaataagac cgccaatgaa aagtatttaa atgcttactt gaactttttg gtggaacttg       840
     gagtcctctt gggcggctca caggacacct cgcagaaaat gatggaggag atcatcgagt       900
     ttgaaaccac cctggcaaac attactgtgc ctcaggtgga gcgacgggat gaggagaaaa       960
     tatattataa aatccaagcc aaagagttgg cgacattggc tcctgccata gactggatgc      1020
     ctttcctctc ttctgttttt gccccggttg aactaaataa ttctgaacct gtggtcgtat      1080
     acgctaaaga atacctccag aaagtctccg agctcatcag caacacaaac aaaagtgtct      1140
     taaacaacta catgatcatg aaagtggtgc ggaaaatggt gtccatctta gaccagaagt      1200
     tccaggatgc agagcagcgt ttccttgaag tcatgtacgg caccaaaaag agctgcatgc      1260
     cacgctggaa actttgcgtc agcgacacgg acagcgctct gggctttgct ctcggggcgc      1320
     tctttgtcaa agctactttt tccgaagaca gcaaagcttt tgttgaagat atggtctccg      1380
     agatcaaatg ggcctttgaa gacagcttga agactgtcag ctggatggat cccgagacaa      1440
     aaaaagcagc caaagaaaag gctgatgcaa tatacaacat ggtgggttat ccaaaattta      1500
     ttatgaaccc caaagagctg gacaaggtgt ttaatgattt tgatgttgtt tcagatctct      1560
     actttcaaaa tgtcatgaat tattacaact tctctgcacg agtgactgct gaccagctga      1620
     gaaaagcccc caacagagat caatggagta tgactccacc tactgtcaat gcctactaca      1680
     acccgacaaa gaatgagatg gttcttcctg caggcatttt ccaggctccc ttttacaacc      1740
     acgcttggcc aaaagccatg aatttcggtg ggataggtgt ggttatgggg cacgaactca      1800
     cccatgcttt tgatgatcaa ggacgcaaat atgacaagga tggaaatctt gcaaaatggt      1860
     ggcaaaattc gtcagtggaa gcttttcaac accagaccca gtgcatggtg gagcaataca      1920
     gcaactacag tattaacaat gaacccctga atggaaaaca cactttggga gaaaacatcg      1980
     ctgacaacgg aggcctgaat gcggcttaca aggcttatgt aaactggatc aagaagaacg      2040
     gcgaggaggc cagtctgcct gcccttggga tgaacaacca tcaactgttt tttgtgggat      2100
     ttgctcaggt gtggtgctct gttcggactc ctgaaagctc tcacgagggc gtcatcactg      2160
     accctcacag tccttcacgc ttccgggtca tcggcaccat ctccaattct cacgaattct      2220
     ctgagcactt cggctgtaag gcagattcac ccatgaaccc taaacgcaag tgtgagcttt      2280
     ggtgacagtg agattgaacc tggagcagtt accctgcaaa aaatatgcca aacgtctgtc      2340
     tcaggttacc tcatattgac tgccaggtca ctgacagtgg acttattttc ccgcctctta      2400
     atgggaagct ggtgtaaata gagactccat ggacatctat ataatggagt tttattcttc      2460
     tcgaaacact ggaagttagt gctatattgt aataggaagg aattgtgctt tttgcaggtg      2520
     ttttctttga atacatgcct tttataagca aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      2580
//

If you have problems or comments...

PBIL Back to PBIL home page