(data stored in ACNUC8465 zone)

EMBL: BC126084

ID   BC126084; SV 1; linear; mRNA; STD; ROD; 1373 BP.
XX
AC   BC126084;
XX
DT   03-NOV-2006 (Rel. 89, Created)
DT   03-NOV-2006 (Rel. 89, Last updated, Version 1)
XX
DE   Rattus norvegicus mitogen activated protein kinase kinase 2, mRNA (cDNA
DE   clone MGC:156599 IMAGE:8376547), complete cds.
XX
KW   MGC.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1373
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1373
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-OCT-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 780489bd0e9f582f2045a325d4e6a2ec.
DR   Ensembl-Gn; ENSRNOG00000020005; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000027272; rattus_norvegicus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Howard J. Jacob
CC   cDNA Library Preparation: Express Genomics
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 290 Row: p Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 18959213.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1373
FT                   /organism="Rattus norvegicus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_367"
FT                   /clone="MGC:156599 IMAGE:8376547"
FT                   /tissue_type="Liver, 15 day embryo pool, mixed sex, strain
FT                   BN/NHsdMcwi"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:10116"
FT   gene            1..1373
FT                   /gene="Map2k2"
FT                   /note="synonym: Prkmk2"
FT   CDS_pept        128..1330
FT                   /codon_start=1
FT                   /gene="Map2k2"
FT                   /product="mitogen activated protein kinase kinase 2"
FT                   /db_xref="GOA:P36506"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36506"
FT                   /protein_id="AAI26085.1"
FT                   /translation="MLARRKPVLPALTINPTIAEGPSPTSEGASEAHLVDLQKKLEELD
FT                   LDEQQRKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIH
FT                   LEIKPAVRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAK
FT                   RIPEDILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDS
FT                   MANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGR
FT                   PVVDGADGEPHSVSPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSS
FT                   DFQEFVNKCLIKNPAERADLKLLTNHAFIKRSEGEDVDFAGWLCRTLRLKQPSTPTRTA
FT                   V"
XX
SQ   Sequence 1373 BP; 280 A; 425 C; 418 G; 250 T; 0 other;
     ctctcgccgg cgctcccggc tttgccgcct tccaccttct gcccggccta ggccgcagcc        60
     ccgggcccgg ttcgcgctgc cccctatggg ccccggctga ggtgccgccg ccggccgcag       120
     agccctgatg ctggcccgga ggaagccggt gttaccggcg ctcaccatca accctaccat       180
     cgctgagggc ccgtccccca ccagcgaggg cgcctccgag gcacacctgg tggacctcca       240
     gaagaagttg gaagagctgg acctggatga acagcagagg aagcggctgg aggccttcct       300
     tacccagaag gccaaggttg gtgagctcaa ggacgacgac tttgagagaa tctcagaact       360
     gggtgcaggc aatggcggcg tggtcacaaa ggcccggcat aggccctctg gcctcatcat       420
     ggccagaaag ctgatccacc tggagatcaa gccagctgtc cgcaaccaga tcatccggga       480
     gctgcaggtg ctgcatgagt gcaactcacc gtacatcgtg ggcttttatg gggccttcta       540
     cagcgacggc gagatcagca tctgcatgga gcacatggac ggtggctcac tggaccaggt       600
     actgaaggag gccaagcgca ttcccgagga catcttaggg aaggtcagca ttgcggtgct       660
     ccggggcctg gcgtacctcc gcgagaagca ccagatcatg catagagatg tgaagccctc       720
     caacattctg gtgaactctc gtggagagat taagctgtgc gacttcggag tgagcggcca       780
     gttgattgac tccatggcca actcatttgt agggacacgc tcctacatgt ccccagaacg       840
     gctgcagggc acccactact ctgtgcagtc ggacatctgg agcatggggc tgtcgctggt       900
     ggagctggcc atcgggaggt accccatccc cccacctgat gccaaggaac tagaggccag       960
     ctttggccgg cctgtggtgg acggggcaga tggagagccc catagtgtct caccgcggcc      1020
     ccggccccct ggacgcccca tcagtggtca tgggatggac agccgaccag ccatggccat      1080
     ctttgagctg ctggactaca tagtgaatga gccacctccc aagctgccca gtggtgtgtt      1140
     cagctcagac ttccaggagt ttgtgaataa atgtctcatt aagaacccag cagagcgtgc      1200
     agacctcaag ctgctgacga accatgcctt catcaaacgc tctgaggggg aggacgtgga      1260
     cttcgctggc tggctatgca gaaccctgcg gctgaagcag cccagcacac ccacgcgtac      1320
     tgcagtgtga cagccatcgc tcagcagtct gtgtccttgt ccctgtgggc aca             1373
//

If you have problems or comments...

PBIL Back to PBIL home page