(data stored in ACNUC16935 zone)

EMBL: BC127395

ID   BC127395; SV 1; linear; mRNA; STD; VRT; 1800 BP.
XX
AC   BC127395;
XX
DT   06-NOV-2006 (Rel. 89, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Danio rerio zgc:153686, mRNA (cDNA clone MGC:153686 IMAGE:8108232),
DE   complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1800
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1800
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-NOV-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d94b7a7076f2dbee2d4b4d0fee7a6023.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: John Postlethwait, University of Oregon
CC   cDNA Library Preparation: Dr. Sumio Sugano
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 285 Row: i Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Similarity but not
CC   identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1800
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_5"
FT                   /clone="MGC:153686 IMAGE:8108232"
FT                   /tissue_type="Ovary"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..1800
FT                   /gene="zgc:153686"
FT   CDS_pept        79..1680
FT                   /codon_start=1
FT                   /gene="zgc:153686"
FT                   /product="zgc:153686"
FT                   /db_xref="GOA:A0JPF1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:A0JPF1"
FT                   /db_xref="ZFIN:ZDB-GENE-061110-88"
FT                   /protein_id="AAI27396.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLCLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI
FT                   PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEP
FT                   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQ
FT                   IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
FT                   QKESTLHLVLRLRGGK"
XX
SQ   Sequence 1800 BP; 510 A; 494 C; 435 G; 361 T; 0 other;
     cagattcgct cctgagacga gaggaaagag actcccatac accgcactct tacagaaaag        60
     aacatttgtt tcgtaaagat gcagatcttt gtgaagacgc tgactggtaa gaccatcacc       120
     ctcgaggtcg agcccagcga caccattgag aatgtcaagg ctaaaattca agataaggag       180
     ggcattcctc ctgaccagca gcgtctgatc ttcgctggaa aacagttaga ggatggacgc       240
     accctgtccg actacaacat ccagaaagag tccaccctcc acctggtgct ccgcctcagg       300
     ggtggcatgc agatctttgt gaagacgctg actggcaaga ccatcactct agaggtggaa       360
     ccaagcgaca ccattgagaa cgtcaaggct aaaattcaag ataaggaggg catcccacct       420
     gaccagcagc gtctgatctt tgctggcaag cagcttgaag atggacgcac cctgtccgac       480
     tacaacattc agaaggagtc caccctccac ctggtgctgc gtctgagagg cggtatgcag       540
     atcttcgtca agactctgac aggaaaaacc atcactcttg aggtcgagcc cagtgacacc       600
     attgagaacg tgaaagccaa gattcaagat aaggagggca tcccacctga ccagcagcgt       660
     ctgatctttg ctggcaaaca gcttgaagat gggcgcaccc tgtccgacta caacatccag       720
     aaagagtcca ccctccatct tgttctccgc ctcaggggcg gcatgcagat cttcgtgaag       780
     acgctgactg gcaagaccat cactttggag gtcgagccca gcgacaccat tgagaacgtc       840
     aaggctaaaa ttcaagataa ggagggcatc ccacctgacc agcagcgtct gatctttgcc       900
     ggcaagcagc ttgaagatgg acgcaccctg tctgactata acatccagaa ggagtccacc       960
     ctccacctgg tgctctgcct caggggtggt atgcagatct tcgtgaagac gctgactggt      1020
     aagaccatca ctcttgaggt cgagcccagc gacaccattg agaacgtgaa agccaagatt      1080
     caagataagg agggcatccc acctgaccag cagcgtctga tctttgccgg caagcagctt      1140
     gaagatgggc gcaccctgtc agactataac atccagaaag agtccaccct ccacctggtg      1200
     ctgcgtctga gaggcggtat gcagatcttc gtcaagacct taactggcaa gaccatcact      1260
     cttgaggtag aaccaagtga caccattgag aacgtgaagg caaaaatcca ggacaaggag      1320
     ggcatcccac ctgaccagca gcgtctgatt ttcgctggca agcagcttga agatggacgc      1380
     accctgtccg actacaacat ccagaaggag tccaccctcc acctggtgct ccgcctcagg      1440
     ggtggtatgc agatcttcgt caagacgctg actggcaaga ccatcacact cgaggtggaa      1500
     ccaagcgaca ccattgagaa cgtgaaggcc aaaatccagg ataaggaggg catcccacct      1560
     gaccagcagc gtctgatctt cgctggcaag cagcttgaag atggacgcac tctgtccgac      1620
     tacaacatcc agaaggagtc caccctccac ctggtgctgc gtcttcgtgg cggcaaataa      1680
     tctgcttatg attaatcatt aatatataca agtcttgaat tatcagacca attccagttt      1740
     cctttattcc tcttaatcat tcaataaagt tcttgcattc cagaaaaaaa aaaaaaaaaa      1800
//

If you have problems or comments...

PBIL Back to PBIL home page