(data stored in ACNUC7820 zone)

EMBL: BC127982

ID   BC127982; SV 1; linear; mRNA; STD; MUS; 943 BP.
XX
AC   BC127982;
XX
DT   23-NOV-2006 (Rel. 89, Created)
DT   23-NOV-2006 (Rel. 89, Last updated, Version 1)
XX
DE   Mus musculus olfactory receptor 845, mRNA (cDNA clone MGC:157541
DE   IMAGE:40135240), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-943
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-943
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (18-NOV-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 4207544e6ed82eddc750fbc509486b51.
DR   Ensembl-Gn; ENSMUSG00000061614; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034390; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034369; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034296; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034361; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034074; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034884; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033399; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034047; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034204; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034148; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034290; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034193; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034903; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033106; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033517; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000071259; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213344; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215572; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091291; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0091367; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0091308; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091294; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090869; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091818; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091450; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0090797; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0091012; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0090844; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0091030; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090865; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0092131; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090891; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089903; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCG Plate: 13 Row: b Column: 11.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..943
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_285"
FT                   /clone="MGC:157541 IMAGE:40135240"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO with reversed insert;
FT                   Clone identification sequence tag: GCTTATCT sequenced from
FT                   the forward primer"
FT                   /db_xref="taxon:10090"
FT   gene            1..943
FT                   /gene="Olfr845"
FT                   /note="synonyms: MOR150-1, MOR150-2"
FT   CDS_pept        5..943
FT                   /codon_start=1
FT                   /gene="Olfr845"
FT                   /product="olfactory receptor 845"
FT                   /db_xref="GOA:Q7TRG2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRG2"
FT                   /protein_id="AAI27983.1"
FT                   /translation="MESTNQTDAIEFLLLGLSDDPELQPIIFGLFLFMYLVTFLGNLII
FT                   TLTISAECHLHTPMYFFLSNLSVADICISSTTVPKMLLNIQTPDHRITYSGCLTQACFV
FT                   LLFAGLENCLLAAMAYDRYVAICHPLRYTVIMNSCFCSILIVVSLAISAVNALLLSLMV
FT                   LHLNFCTEVEIPHFFCELAQIIKLACSDTLINNILIYISAFMFGGIPFFGIFLSYTEIV
FT                   SSVLKIPSRQGRHKAFSTCGSHLSVVSLFYGTGLGVYISSAVTESPRKTAVASVMYSIV
FT                   TQMLNPFIYSLRNRDMKEALRKHVGRIASIV"
XX
SQ   Sequence 943 BP; 237 A; 218 C; 177 G; 311 T; 0 other;
     aacaatggaa tccaccaatc aaacagatgc aatagaattt ctgctcttgg gcctttcaga        60
     tgatccagag ttacagccca ttattttcgg actgttcctg tttatgtacc tggtcacatt       120
     tctggggaac ctaattataa ccctgaccat cagtgctgag tgccatctcc atacccccat       180
     gtactttttt ctctccaatc tatctgtggc tgatatctgt ataagctcaa ctacagtccc       240
     aaagatgctc ttgaacatcc aaacaccgga tcacagaata acttactcag gttgcctcac       300
     tcaggcttgc tttgtcttgc tttttgctgg attagaaaat tgcttgcttg cagcaatggc       360
     ctatgaccgc tatgtggcca tttgccaccc tctgaggtac acagtcatca tgaactcatg       420
     cttctgtagt atacttattg tagtttcctt ggctattagt gctgtcaatg cactactgct       480
     cagtctcatg gtgctgcatc tgaatttctg cacagaggtt gaaatcccac acttcttctg       540
     tgaacttgct cagatcataa agcttgcctg ctcagatact ctcataaata atattttgat       600
     ttatatctca gctttcatgt ttggtggtat tcctttcttt ggaatatttc tttcttatac       660
     tgaaattgtc tcctctgttt tgaaaattcc atcaaggcaa ggaaggcata aagcattttc       720
     cacgtgtggc tctcacctgt cagtagtttc cttgttttat gggacaggct taggagtgta       780
     cattagctct gcagttactg aatctcccag gaaaacagcc gttgcttcag taatgtactc       840
     tattgtcact cagatgctga acccttttat ctacagcctg aggaacagag acatgaagga       900
     agctttaagg aagcacgttg gaaggatagc ttccattgta taa                         943
//

If you have problems or comments...

PBIL Back to PBIL home page