(data stored in ACNUC27125 zone)

EMBL: BC129382

ID   BC129382; SV 1; linear; mRNA; STD; VRT; 2247 BP.
XX
AC   BC129382;
XX
DT   03-JAN-2007 (Rel. 90, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Danio rerio zgc:158685, mRNA (cDNA clone MGC:158685 IMAGE:7288968),
DE   complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-2247
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2247
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (22-DEC-2006) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 2fe9ac026982f6f924978c52627adab0.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: John Ngai, Univ of CA, Berkeley
CC   cDNA Library Preparation: Dr. Sumio Sugano
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 294 Row: g Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis, Similarity but not identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2247
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_4"
FT                   /clone="MGC:158685 IMAGE:7288968"
FT                   /tissue_type="Brain"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..2247
FT                   /gene="zgc:158685"
FT   CDS_pept        305..1825
FT                   /codon_start=1
FT                   /gene="zgc:158685"
FT                   /product="zgc:158685"
FT                   /db_xref="GOA:A1L277"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="UniProtKB/TrEMBL:A1L277"
FT                   /db_xref="ZFIN:ZDB-GENE-070112-1102"
FT                   /protein_id="AAI29383.1"
FT                   /translation="MSGKDQNKQSTTERLVKAVPYPPTTRLTMKELYEDGKPKVELLKS
FT                   HLVKEGRLEEDVALRIINDGANILRHEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGS
FT                   PHNTRYLFLGDYVDRGYFSIECVLYLWALKINHPTTLFLLRGNHECRHLTEYFTFKQEC
FT                   KIKYTERVYDACMEAFDCLPLAALLNQQFLCVHGGLSPEVTCLDDIRKLDRFKEPPAFG
FT                   PMCDLLWSDPGEDYGSEKTSEHFCHNSVRGCSYFYSYPAVCDFLTNNNLLSVIRAHEAQ
FT                   DAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYEDNVMSIRQFNCSPHPYWL
FT                   PNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSEGDDTCEVRKEVIRNKIRAIGKM
FT                   ARVFSVLREENESVLQLKGLTPTGMLPLGVLSGGRQTLQSATVEAEEARAIQGFNPQHK
FT                   IQSFEEARGLDRINERMPPRRDTKQPDGTANSINAANSPDKNGTNAQA"
XX
SQ   Sequence 2247 BP; 597 A; 568 C; 545 G; 537 T; 0 other;
     atcgctactc cctcagagaa attgacagca gctgggtcgc ctgtgtgagc aaacccgaag        60
     gacagacacg gcagaaaata aaactctgcc gttgcagtgg gctccccctt cccctttccc       120
     ccaccgtttg agcgaacata tcagtaaagc gacccggacg agctctctga ctccgtttcc       180
     ccgctttcac agcggagcgg tcaggacttt tgtcagtagc ttagccgagc tagcgggcta       240
     acacgactag ctgggttcag ctacaacaag gaattacaaa tattccaccg agaaacactg       300
     aagaatgtcg gggaaggatc agaataaaca atccaccacc gaacggctcg tgaaagcggt       360
     gccgtaccct cccacaacgc ggctcaccat gaaagagctg tacgaggacg gcaagcccaa       420
     ggtggagctt ttgaagagcc acctggtgaa agagggccgc ctggaggagg acgtggccct       480
     acgcatcatc aacgatggag ccaacatcct ccgccacgag aagtgcatgc tggaagtcga       540
     ggcgcccatc acagtgtgcg gagatgtcca cgggcagttc ttcgacctga tgaagctctt       600
     cgaggtgggg ggttccccgc acaacacacg ctatctattt ttgggagact acgtggatcg       660
     aggctatttt agtattgagt gtgtgctcta tctgtgggct ctgaagatca accacccgac       720
     caccctcttc ctcctcagag gcaaccacga gtgtcggcat cttacggagt acttcacctt       780
     taaacaagaa tgcaagatta agtacacgga gcgggtgtat gatgcctgca tggaggcctt       840
     cgactgcctt cctctggccg ctctgctcaa ccagcagttc ctctgcgttc acggaggtct       900
     ttctcctgag gtcacctgcc tcgacgacat ccggaaatta gacaggttta aagagccgcc       960
     agctttcggc ccgatgtgcg acttgctgtg gtctgaccct ggcgaggact acggcagcga      1020
     aaagacctcc gagcactttt gtcacaacag cgtgagagga tgttcctatt tctacagtta      1080
     ccctgcagta tgtgactttc tgacgaataa taacttgttg tcagttataa gagcacatga      1140
     agcccaagat gcagggtatc gaatgtacag aaaaagtcag acgacaggct tcccctcatt      1200
     aatcacaatc ttctctgcac caaactactt agacgtgtat aacaataaag ctgctgtgtt      1260
     gaaatacgag gacaacgtga tgagcatccg gcagttcaat tgctctcctc atccatactg      1320
     gctgcccaac ttcatggatg tcttcacatg gtcattgccc ttcgttgggg agaaagtaac      1380
     ggagatgctg gtcaacgtgt tgaacatctg ttcagatgat gagctcatgt cagagggaga      1440
     cgacacctgc gaagtccgca aggaggtgat ccgaaataag attcgtgcca ttggcaagat      1500
     ggccagagtt ttctctgttc ttagagagga gaatgagagc gtgctgcagt taaagggctt      1560
     gacccccact gggatgctgc ctctaggtgt gctgtcaggg ggccgtcaga ccctccagag      1620
     cgccaccgta gaagcagagg aagcacgagc tatccaaggc ttcaatcctc aacacaagat      1680
     ccaaagcttc gaggaagcac gcgggctgga ccggataaat gagcgaatgc ctccacgcag      1740
     ggacaccaag cagccagacg gcactgccaa ctccatcaac gcagccaatt cccccgacaa      1800
     gaatggcacc aacgcacagg cgtagtaacc tagcagctac ctagcgctct ccctcatcct      1860
     ttcctttctg tctcttttgt ttttttattt ttgttttatt ttcttctctc tgtctgtctc      1920
     tctttttttt cctctcattc tctctctttt tggtagaggt gatgccccct acatgctaaa      1980
     ctctcctgga ccatttcggg gagaatcgca caataccatg aagagggcgt agtgaaaaaa      2040
     caaaccatgg ttcttattta tttattgatt atagatgata agaaatttaa gatctgtaac      2100
     ggtgggatga aattgagatg aatgaatacc tacatgatga aatattacat gtgtacataa      2160
     aatacagaat atatatatat agacatagca ttggggtggt tgtaaggtca tcttagattc      2220
     tgtagtttaa aaaaaaaaaa aaaaaaa                                          2247
//

If you have problems or comments...

PBIL Back to PBIL home page