(data stored in ACNUC23405 zone)

EMBL: BC132283

ID   BC132283; SV 1; linear; mRNA; STD; MUS; 1369 BP.
XX
AC   BC132283;
XX
DT   02-FEB-2007 (Rel. 90, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus motor neuron and pancreas homeobox 1, mRNA (cDNA clone
DE   MGC:163914 IMAGE:40130560), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1369
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1369
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-JAN-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 878e354d892f11c0ff1a419c52e1c2be.
DR   Ensembl-Gn; ENSMUSG00000001566; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029376; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029342; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029293; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029353; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029074; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029806; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028485; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029042; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029191; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029149; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029276; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029178; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029840; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028209; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028565; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000165512; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070603; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0070681; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0070594; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070605; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070252; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071083; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070787; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0070192; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0070329; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0070241; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0070404; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070267; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071285; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070256; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069410; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 6 Row: A Column: 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1369
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:163914 IMAGE:40130560"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CAAACCCT"
FT                   /db_xref="taxon:10090"
FT   gene            1..1369
FT                   /gene="Mnx1"
FT                   /note="synonyms: HB9, MNR2"
FT   misc_feature    1..1369
FT                   /gene="Mnx1"
FT                   /note="This cDNA sequence aligns to the mouse C57BL/6J
FT                   genome (build 36) without differences"
FT   CDS_pept        109..1323
FT                   /codon_start=1
FT                   /gene="Mnx1"
FT                   /product="motor neuron and pancreas homeobox 1"
FT                   /db_xref="GOA:A2RSX2"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:109160"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSX2"
FT                   /protein_id="AAI32284.1"
FT                   /translation="MEKSKNFRIDALLAVDPPRAASTQSAPLALVTSLATTVSGPGRGG
FT                   SGGGGTSSGASRSCSPASSEATAAPGDRLRAESPSPPRLLAAHCALLPKPGFLGAGGGG
FT                   GAAGGPGTPHHHAHPGAAAAAAAAAAAAAAGGLALGLHPGGAQGGAGLPAQAALYGHPV
FT                   YSYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGASTFQLDQWLRASTAGMI
FT                   LPKMPDFSSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLT
FT                   ETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGTGKGGSEEKTEEELMGPPVSG
FT                   DKASGRRLRDLRDSDPDEDEDDEEEDNFPYSNGAGAHAASSDCSSEDDSPPPRLGGPGH
FT                   QPLPQ"
XX
SQ   Sequence 1369 BP; 257 A; 465 C; 446 G; 201 T; 0 other;
     taacaatacc ggccccaagg ctggccaccg ccacgctcag tctccgtaag cccgcacacg        60
     actgcatcgc ccacccttgg accctgattg tcagctccaa tcgagccgat ggaaaaatcc       120
     aaaaatttcc gcatcgacgc cctgctggcc gtggatcccc cgcgagccgc ctccacgcag       180
     agcgcgcctc tggccttggt cacttccctc gcgactacag tatctggtcc cggccgcggc       240
     ggcagcggcg gcggggggac cagtagcggg gcgagccgta gctgcagtcc cgcatcctcg       300
     gaggccactg cagcgcccgg tgaccggctg agagctgaga gcccgtcgcc cccacgcttg       360
     ctggctgcac actgcgcgct gctgcccaag cccggattcc tgggcgccgg aggaggcggc       420
     ggcgcggcgg gtgggccggg cactccccac caccacgcgc accctggtgc agcagccgcc       480
     gcggctgccg ctgccgctgc cgcggctgcc ggtggcctgg cactggggct gcacccgggg       540
     ggcgcacagg gcggcgcggg cctccctgca caggcggctc tctatggaca cccggtctac       600
     agttattcgg cagcagctgc agcggccgcg ctagctggcc agcacccggc gctttcctac       660
     tcataccctc aggtgcaggg cgcgcaccct gcgcaccctg ccgaccccat caagctgggt       720
     gccagcacct tccaactgga ccagtggctg cgcgcgtcta ctgcgggcat gatcctgccc       780
     aagatgccgg acttcagctc ccaggcgcag tcgaacctct tggggaagtg ccgaaggcct       840
     cgcacggcct tcaccagcca gcagctgttg gagctggaac accagttcaa gctcaacaag       900
     tacctgtctc gacccaagcg ttttgaggtg gctacctcgc tcatgctcac cgagactcag       960
     gtgaagattt ggttccagaa ccgccgaatg aaatggaaac gcagcaaaaa ggccaaagag      1020
     caggctgcgc aggaggcgga gaagcagaag ggcggcggcg ggggcaccgg caaaggcggc      1080
     agtgaggaga agacggaaga ggagctgatg gggcctccgg tttcggggga caaggcaagc      1140
     ggccgtcgcc tgcgggactt gcgggacagt gaccctgatg aggacgagga tgatgaagaa      1200
     gaggacaact tcccgtacag caatggtgcc ggtgcccatg ctgcctcatc cgactgctca      1260
     tctgaggacg actcgcctcc tccaagacta ggcgggcctg gacaccaacc tctgccccag      1320
     tagttgcctc cagggcggaa gcagggatgc gaaagatggc tacctgggg                  1369
//

If you have problems or comments...

PBIL Back to PBIL home page